2F9Z,1SQU,3HZH


Conserved Protein Domain Family
CheC

?
pfam04509: CheC 
Click on image for an interactive view with Cn3D
CheC-like family
The restoration of pre-stimulus levels of the chemotactic response regulator, CheY-P, is important for allowing bacteria to respond to new environmental stimuli. The members of this family, CheC, CheX, CheA and FliY are CheY-P phosphatase. CheC appears to be primarily involved in restoring normal CheY-P levels, whereas FliY seems to act on CheY-P constitutively. CheD enhances the activity of CheC 5-fold, which is normally relatively low. In some cases, the region represented by this entry is present as multiple copies.
Statistics
?
PSSM-Id: 398287
Aligned: 28 rows
Threshold Bit Score: 40.9125
Threshold Setting Gi: 81531058
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2F9Z_B       105 FSASALREIGNIMCGTYVSALADFLgFKIDTLPPQLVI 142 Thermotoga maritima MSB8
Q9KDX3        84 IGWSAVQEFGNWVAGNTATELSKEA-CIIDVTPPVVNE 120 Bacillus halodurans
Q24YC8        85 FVKSALGEIANIISGNAMTGLSQSQ-VVCDIRPPKILe 121 Desulfitobacterium hafniense Y51
Q81FG1       122 LELSAVQEAMNQMMGFAATSMSEFFqDTVDMSPPTIKv 159 Bacillus cereus ATCC 14579
Q97H00       138 IELSAVSEAMNQMIGSAATSMATMLlREVNISPPVSKI 175 Clostridium acetobutylicum
P24073       133 IHLSAVQEAMNQMMGSAATSMSTVFsKKIDISPPRVEL 170 Bacillus subtilis subsp. subtilis str. 168
Q9KA45       146 MHISAVQEAMNQMMGSASTSMSTIFnKRIDISPPGVNM 183 Bacillus halodurans
1SQU_B        84 LALSAIGELGNMTAGKLAMKLEHLG-KHVDITPPTVVS 120 Thermotoga maritima
3HZH_B       100 xVAATLTEVGNIIAGNFVTTLHAKG-FVFDITPPAFIY 136 Lyme disease spirochete
WP_024470638  64 lARATITELANLITAQAVTKLHDLG-FKFDLTPPALFs 100 Treponema pedis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap