Conserved Protein Domain Family
SAPS

?
pfam04499: SAPS 
SIT4 phosphatase-associated protein
This family includes a conserved region from a group of yeast proteins that associate with the SIT4 phosphatase. This association is required for SIT4's role in G1 cyclin transcription and for bud formation. This family also includes homologous regions from other eukaryotes.
Statistics
?
PSSM-Id: 398279
Aligned: 49 rows
Threshold Bit Score: 236.368
Threshold Setting Gi: 1573759182
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KIS68733                       215 NGAYLERKPIEMLEFIKEQPRIVERFVAHLETPAVVDLLFRIIQMEETmrtpVQTTDIIDWLSS-QDLVSRTVDLLAPNY 293  Ustilago maydis 521...
Q22CQ3                         223 vlslVQMKPQEMIEYILTSQGVLDGLFRHINNQSIASVVQTLLILESN----KFSSQTQEFLKDfTDIKVKAIGEFIDKF 298  Tetrahymena thermophila SB210...
Q23RZ9                         289 ainnvltsNGQFYNFISDKPEVLEQLIKHIRTKSIAEVVLKLIT--------TVGTEKEEQFNE-ER--KRLLTLLNAKF 357  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  326 NKN----KDIEVIEYLYKNENNLLNMTKQMQSRSCSDILVKSISFTNQ----KLKEKFLNIK---LKVIDKLIELLSDEN 394  Tetrahymena thermophila SB210...
Q43540                          94 VECLMFHKVTPLVRYFQGHPEIFHELVDLIGIASIKEVLIQLIGADSKkdafSPPAELVHLLEE-IDLLEAILDKFSSS- 171  trumpet lily...
Q8L7T5                         129 VICLMIRKTAALMNYVKGHQNVFCQLVDLIGITSIMEVLVRLVGADDQv--yPNFLDVMQWLAD-SNLLEMIVDKLKPSS 205  thale cress...
Q9UPN7                         128 MGILINRKTDQLVSFLRKKDDFVDLLLQHIGTSAIMDLLLRLLTCVERp---QLRQDVVNWLNE-EKIVQRLIEQIHPSK 203  human...
Q6PCI0                         128 MGILINRKTEQIIAFLRKKDDFVSLLLQHIGTSAIMDLLLRLLTCVEQp---QLRQDVFNWLNE-EKIVQRLIEMIHPTK 203  African clawed frog...
Q922D4                         128 LSILISRKPEQIVDFLKKKRDFVDLIIKHIGTSAIMDLLLRLLTCIEPp---QPRQDVLNWLNE-ERIIQRLVEIVHPSQ 203  house mouse...
Q4RZH1                         128 LSILIGRKPERIVEFLRKQEDFVDLMIKHIGTSAIMDLLLRMLTCIEPq---QLRQDVLCWLNE-EKVIQRLVDMVQPSQ 203  spotted green pufferfish...
KIS68733                       294 --SVDI-HNTVSELLKAIIALSAPSPAALNQGQGQdlggglgeaqenaaginNRLVRELASEPIVRKMVGYMLdsqmprq 370  Ustilago maydis 521...
Q22CQ3                         299 --GEY-----CSEEIQNLALIFTEIISKYYLIQDG-----------------KEMLEYLCSEESVEKIFKFMI------- 347  Tetrahymena thermophila SB210...
Q23RZ9                         358 lsGESFeRENISYIIHEIISTFIQGDNQYRINKCP-----------------ASVQQIILEESFIETFFKVIV------- 413  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  395 --NDLEvFANTVLCFQELISYYTNYTDG------------------------KQIVEYVISQPIFSKLLNNSTs------ 442  Tetrahymena thermophila SB210...
Q43540                         172 --DSSIvQANATNILCAII------------DYAP-----------------SQIAAKIYSPSFVRRLFDHAL------- 213  trumpet lily...
Q8L7T5                         206 --PPEV-QANAAETLCAI---SRNAP--------------------------SALATQLSSPGYVAKIFGHAL------- 246  thale cress...
Q9UPN7                         204 --DENq-HSNASQSLCDIIRLSREQMIQVQDSPEP-----------------DQLLATLEKQETIEQLLSNMF------- 256  human...
Q6PCI0                         204 --DDNq-HSNASQSLCDIIRLSREQMIQIQDSPDP-----------------DQLLATLEEQETIEQLLSNMF------- 256  African clawed frog...
Q922D4                         204 --EEDr-HSNASQSLCEIVRLSRDQMLQVQNSTEP-----------------DPLLATLEKQEIIEQLLSNIFh------ 257  house mouse...
Q4RZH1                         204 --DEDVrHSNASQSLCEIIRLSRDQMFQVQGCSEP-----------------DPLLATLEKQETVEQLLSNIF------- 257  spotted green pufferfish...
KIS68733                       371 lhrrltdvvdeqlsqlsvqdlrkpsqrrdaalstleegvasssaldddeddnesfarplnprefpaseSRspgqidhrgs 450  Ustilago maydis 521...
Q22CQ3                         348 --------------------------------------------------------------------HG---------- 349  Tetrahymena thermophila SB210...
Q23RZ9                         414 --------------------------------------------------------------------DE---------- 415  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  443 --------------------------------------------------------------------QNa--------- 445  Tetrahymena thermophila SB210...
Q43540                         214 --------------------------------------------------------------------NDs--------- 216  trumpet lily...
Q8L7T5                         247 --------------------------------------------------------------------EDs--------- 249  thale cress...
Q9UPN7                         257 --------------------------------------------------------------------EGe--------- 259  human...
Q6PCI0                         257 --------------------------------------------------------------------EGe--------- 259  African clawed frog...
Q922D4                         258 --------------------------------------------------------------------KE---------- 259  house mouse...
Q4RZH1                         258 --------------------------------------------------------------------DKe--------- 260  spotted green pufferfish...
KIS68733                       451 tatvrpdnlfppvsaptvpitaeTCSS----TLVTCIGVFIELIRKNNS-DYfeqhllrtlhnhlvkrqseltekrlqkk 525  Ustilago maydis 521...
Q22CQ3                         350 -------------------------SD----GAKNGACQIIQALAQYYAfNA---------------------------- 372  Tetrahymena thermophila SB210...
Q23RZ9                         416 -----------------------NSDSssvgYAASILGIMVTFYNSKQK-QK---------------------------- 443  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  446 -----------------------KIAY----HNASVVCIIIQLFNVIESrRS---------------------------- 470  Tetrahymena thermophila SB210...
Q43540                         217 ----------------------qPIKT----VLIQSLAVFISLLDSERL-AS---------------------------- 241  trumpet lily...
Q8L7T5                         250 -----------------------HSKS----GLVHSLSVCTSLLDPRRS-AV---------------------------- 273  thale cress...
Q9UPN7                         260 -----------------------QSQS----VIVSGIQVLLTLLEPRRP-RS---------------------------- 283  human...
Q6PCI0                         260 -----------------------HNES----VIVNGTQVLLTLLEPRRP-RS---------------------------- 283  African clawed frog...
Q922D4                         260 -----------------------KNES----AIVSAIQILLTLLETRRP-TF---------------------------- 283  house mouse...
Q4RZH1                         261 -----------------------KNES----AIVSVIQILLTLFETRRP-AF---------------------------- 284  spotted green pufferfish...
KIS68733                       526 eEEEAAMPKSTqqqgeaagsaeaekqddgelaqkamdtldeeEEDVQGMEEAmaeivdkmglVHLGP-MLRVLSERLSDF 604  Ustilago maydis 521...
Q22CQ3                         373 -NSFISGYPEG-------------------------------SEYYMIMLQQ-----------YENMaFLKTLSSSFDAL 409  Tetrahymena thermophila SB210...
Q23RZ9                         444 -GNVNSSHQSD-------------------------------EEDVVIEECS----------QNIAFpAEKLFSQYIPSL 481  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  471 ------------------------------------------DEDEPSFQEFd---------IDYND-ALQLFSTYIKAT 498  Tetrahymena thermophila SB210...
Q43540                         242 -ASNQL------------------------------------RTNNSSHRSL----------VTTSHeTVECMLESLGNL 274  trumpet lily...
Q8L7T5                         274 -SSSMFNSY----------------------------------RGQHMFESP----------VPVSPeTIGAMLPKLNDL 308  thale cress...
Q9UPN7                         284 -ESVTVNSFFSsvd-------------------------gqlELLAQGALES----------TVSSVgALHALRPRLSCF 327  human...
Q6PCI0                         284 -ELGGMSGFYCnld-------------------------gqlEINAAGLDSTsn------tqASLG--TLLAIKEHLHQF 329  African clawed frog...
Q922D4                         284 -EGHI-------------------------------------EICPPGMSHSa---------CSVNKsVLEAIRGRLGSF 316  house mouse...
Q4RZH1                         285 -EGHM--------------------------------------ECPPGISHPs---------FSVNHsILEAVRPRLKDF 316  spotted green pufferfish...
KIS68733                       605 QQLVNEPRERdaTIPTSVGNva--pLTFERYRITELYAELLHCSNMALLNRapgegpqysddgvltggleglqtlartlq 682  Ustilago maydis 521...
Q22CQ3                         410 ADILAGKDSN------AAGGnsravLGIHRLKIIEIMNQVIRIQFPSVQEG----------------------------- 454  Tetrahymena thermophila SB210...
Q23RZ9                         482 IKFISSKPEGa-AHTTSYGAei-vpFGIGKLKVVDLISHVFKSENKELISQ----------------------------- 530  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  499 IDYLKNYQQDe-TIKTVYRQel-kpLGQSRLKIVEIYCVALKQSNFYVVQE----------------------------- 547  Tetrahymena thermophila SB210...
Q43540                         275 LELLDISSSGd-SLPTTYGSlk-ppLGRYRVKIVEFISVLLRIGSEVAEKK----------------------------- 323  trumpet lily...
Q8L7T5                         309 LMLLTVASDSt-VLPTTYGElr-ppLGKHRLKIVEFIAVLLKTRSEAAQKE----------------------------- 357  thale cress...
Q9UPN7                         328 HQLLLEPPKLe-PLQMTWGMla-ppLGNTRLHVVKLLASALSANDAALTHE----------------------------- 376  human...
Q6PCI0                         330 HQLLIDPPKKq-SLQATWGVld-ppLGNTRLHVVKLLASIINANNNVLNQE----------------------------- 378  African clawed frog...
Q922D4                         317 HELLLEPPKKs-VMKTTWGIld-ppVGNTRLNVIRLISSLLQTNTSSINGD----------------------------- 365  house mouse...
Q4RZH1                         317 HQLLLDPPK----------------------------------------------------------------------- 325  spotted green pufferfish...
KIS68733                       683 ggdgpevgdtsasaeaeamqdiggqqdaapkteaaasedtidtdssvahrvsghardqsstgastdstdeaddeallnev 762  Ustilago maydis 521...
Q22CQ3                             --------------------------------------------------------------------------------      Tetrahymena thermophila SB210...
Q23RZ9                             --------------------------------------------------------------------------------      Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A      --------------------------------------------------------------------------------      Tetrahymena thermophila SB210...
Q43540                             --------------------------------------------------------------------------------      trumpet lily...
Q8L7T5                             --------------------------------------------------------------------------------      thale cress...
Q9UPN7                             --------------------------------------------------------------------------------      human...
Q6PCI0                             --------------------------------------------------------------------------------      African clawed frog...
Q922D4                             --------------------------------------------------------------------------------      house mouse...
Q4RZH1                             --------------------------------------------------------------------------------      spotted green pufferfish...
KIS68733                       763 slydkasapvegssslevpsgsqetdsydesprvttsdsveedqddaasirsalsglslaeltapklsgppspideakdy 842  Ustilago maydis 521...
Q22CQ3                             --------------------------------------------------------------------------------      Tetrahymena thermophila SB210...
Q23RZ9                             --------------------------------------------------------------------------------      Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A      --------------------------------------------------------------------------------      Tetrahymena thermophila SB210...
Q43540                             --------------------------------------------------------------------------------      trumpet lily...
Q8L7T5                             --------------------------------------------------------------------------------      thale cress...
Q9UPN7                             --------------------------------------------------------------------------------      human...
Q6PCI0                             --------------------------------------------------------------------------------      African clawed frog...
Q922D4                             --------------------------------------------------------------------------------      house mouse...
Q4RZH1                             --------------------------------------------------------------------------------      spotted green pufferfish...
KIS68733                       843 vvgdmlkrkFLECGILPSLLNLFFDYPWNNFLHNVVYDILQQCF-NGRMDv-----------GLNRKLTVAVF-EQGCLT 909  Ustilago maydis 521...
Q22CQ3                         455 ---------LVNSKILQHMLDLFFKYEWHNILHQIVLNILLFII--QNCDk-----------SKIRAYLKHLL-VDQNFT 511  Tetrahymena thermophila SB210...
Q23RZ9                         531 ---------LAQSGCFKILLELMIEYPWNNLLHVLIEKIVNEGI-TITFN------------GSNDIVKNELFgTSFNLL 588  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  548 ---------MAQHNLHAVLLELFLKYEWNNMLHTLVERVIIQ---SAQIN--------------SHAMRKAVF-TDAKLI 600  Tetrahymena thermophila SB210...
Q43540                         324 ---------LLHLKAIKHVLDLFFEYPFNNVLHRHVVEIVVSCLd-----------------SKNTKLTEHLF-FECDIL 376  trumpet lily...
Q8L7T5                         358 ---------LVSSGTIKRTLDLFFEYPYNNALHHQVESIILSCL-ENKSD----------------LMVNHIL-RDCDLI 410  thale cress...
Q9UPN7                         377 ---------LLALDVPNTMLDLFFHYVFNNFLHAQVEGCVSTMLsLGPPPdss------petPIQNPVVKHLL-QQCRLV 440  human...
Q6PCI0                         379 ---------LIELDTLNTMLDLYFQYMYNNFLHAQVEVCITTILnSSPLEeti------edeAQGSPLVRYLL-QKCHLV 442  African clawed frog...
Q922D4                         366 ---------LMELNSIGVILDMFFKYTWNNFLHTQVEICIALIL-ASPFEnaengtitdqdsTGDNLLLKHLF-QKCQLI 434  house mouse...
Q4RZH1                         326 --------------------DMYFRYIWNNFLHIQVEICTAMIL-AMPPApadiqsdteqehSRESILISHV--NTHHIQ 382  spotted green pufferfish...
KIS68733                       910 SRIVE-GRKRNEdsva---------gprRIRLGYMGH-MNLIAEETVKLLQRYPLEIA-RPVEVFT---ERDEWRQVVSE 974  Ustilago maydis 521...
Q22CQ3                         512 QQMISyVGDTLYyfdka------kypdrCTTKGNLGY-IIKIADEIEKFYQKSVQNRQnSDMLDW----HNQEWINFMEI 580  Tetrahymena thermophila SB210...
Q23RZ9                         589 EFIADkSEEETSrpgk---------ltrEIRQGYIGF-LTLFAKKIQENTS--------SETMKQIk-eANEKWKKYIET 649  Tetrahymena thermophila SB210...
WGS:AAGF:cds.TTHERM_00190658A  601 NFLLE-ATKQVDsdiasd-----aptkvNFRKGYLGH-VTKIANFVQRLCENN------AEIQEYV---DHDLWGQLRDS 664  Tetrahymena thermophila SB210...
Q43540                         377 GRILE-AEKQPTlssdcnkptvstpgksPPRKGNFGH-LTQIANKIVELADKN------SFIQTRLk--ENKEWSDWQNS 446  trumpet lily...
Q8L7T5                         411 GKFLL-SDRDSNllgdsqpt-vaasgkkKPRVGYVGH-ITRISNKIGQLSNSN------GQIKAYLq--ENSEWNEWQGS 479  thale cress...
Q9UPN7                         441 ERILT-SWEENDrvq----------cagGPRKGYMGH-LTRVAGALVQNTEKGPNAEQlRQLLKELpseQQEQWEAFVSG 508  human...
Q6PCI0                         443 QRILS-AWEENDkeq----------segGRRRGFMGH-LTKIANSVVQSSEKGPNVSLvGQLIKDLtdeEQEHWDGFVTG 510  African clawed frog...
Q922D4                         435 ERILE-AWDTNEkkq----------aegGRRHGYMGH-LTRIANCIVHSTDKGPNSALvQQLIKDLpdeVRERWETFCTN 502  house mouse...
Q4RZH1                         383 SASDDeVDFKDSgfh----------qdsSLQQAFSDYqMQQMTSNFIEQFGFNDEEFAd---QDDV---VDIPFDRISDI 446  spotted green pufferfish...
KIS68733                       975 TLE-EIREKEGG 985  Ustilago maydis 521
Q22CQ3                         581 TLD-IHKERGCK 591  Tetrahymena thermophila SB210
Q23RZ9                         650 KFK-FITDRENQ 660  Tetrahymena thermophila SB210
WGS:AAGF:cds.TTHERM_00190658A  665 YLD-QTNQNNNR 675  Tetrahymena thermophila SB210
Q43540                         447 VLF-ERNKLENV 457  trumpet lily
Q8L7T5                         480 VLQ-DRNTVENV 490  thale cress
Q9UPN7                         509 PLA-ETNKKNMV 519  human
Q6PCI0                         511 SLT-ETNKKNTI 521  African clawed frog
Q922D4                         503 SLG-ETNKRNTV 513  house mouse
Q4RZH1                         447 NFSlNTNESANI 458  spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap