Conserved Protein Domain Family
CITED

?
pfam04487: CITED 
CITED
CITED, CBP/p300-interacting transactivator with ED-rich tail, are characterized by a conserved 32-amino acid sequence at the C-terminus. CITED proteins do not bind DNA directly and are thought to function as transcriptional co-activators.
Statistics
?
PSSM-Id: 398273
Aligned: 17 rows
Threshold Bit Score: 205.821
Threshold Setting Gi: 1248989135
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004044806   1 MADH-MMAMNHGrfpdgtn-glhhhpaHRMGM------Gqfps--------phhHQQ-QQPQHAFNAL-MGEHIHYG--- 59  western lowland...
Q1L8S4         1 MAEHiMMPMNHGsagg-------glhgYRMGMn--------------------gPSP-HGHQPSLRTLpNGQLMHYSrgp 52  zebrafish
XP_006631309   1 MADHlMMPMNHGsgggg------glhgFRMGVngslqaG---------------PQQ-HTPPPGLRNLpGGQMMHYGpgp 58  spotted gar
XP_015194522   1 MADR-MMSMNHGrfsesangihphhptRRMAM------GqfsnplhhqqqqqppPQQ-QQQ-HGYNGL-MGEHLHYG--- 67  spotted gar
Q6NX30         1 MADH-MMAMNHSrfqdgtn--glhhpaHRMGM------Gqfsn-------hhhhPQQ-----HTFNSL-MGEHMHYG--- 55  tropical clawed...
Q9DDW4         1 MAEH-MMAMNHGrfpdgag-glhhhpaHRLGM------Gqfaa-------phhhQHQ-QQQPHAFSAL-MGDHIHYG--- 60  chicken
XP_016850503   1 MADH-MMAMNHGrfpdgtn-gmhhhpaHRMGM------Gqfpt-------hhhqQQQ-Q---HAFSAL-MSDHIHYG--- 57  green anole
NP_001006045   1 MVDR-MMAMNHGrfpdavn--ghqhsaRRMGM------Gqfs---------nalPQQqH-----YNVI-MGDHMHYA--- 53  zebrafish
XP_008275622   1 MADHlMMPMNHSsaga-------slhgYRMGM------Nggl---------qagHQQ-HANQQGMRALpNGQMMHYGg-a 56  bicolor damselfish
XP_005795999   1 MGDHmMMSMNHSsagt-------glhgYRMGM------Nggl---------qagHQQ-HANQQGMRALpNGQMMHYGg-n 56  southern platyfish
XP_004044806  60 AGNMNATSGIR-HAMGPG-T----VNG--------GHPPSALAPAARFN------------------------------- 94  western lowland...
Q1L8S4        53 QNSMEVAMRQR-NAMNGI------MNSqvngqmsgGHPHQMQQANMMYAspnqqpqghpqs------------------- 106 zebrafish
XP_006631309  59 QANMEAVMRQR-PGMVAG------MNGqmnn--gqmgHHHQMAGNMMYSsqsqqhhpqqqqq------------------ 111 spotted gar
XP_015194522  68 GGNVNSNHGVR-HSMGPG-N----VTG--------VHPNSSLAPSARY-------------------------------- 101 spotted gar
Q6NX30        56 PGNINANNSIR-HAIVTG-N----VNG--------GHPNGSMAPASRF-------------------------------- 89  tropical clawed...
Q9DDW4        61 AGNMNASGGVR-HAMGPG-G----VGG--------GHPAGSMPPPARFS------------------------------- 95  chicken
XP_016850503  58 GGNMSANAGIRqHAMGPG-N----VSG--------GHPPGTMPPTARFS------------------------------- 93  green anole
NP_001006045  54 GGNINANNGIR-HSMATGnN----ING--------GIPNGNLP--ARF-------------------------------- 86  zebrafish
XP_008275622  57 QANMESAMRQR-QGMVGG-P----MNG--------Qlngaqmghhqmtsgnmmyngqpqqq------qhhpqqqhhmhpq 116 bicolor damselfish
XP_005795999  57 QASMEAAIRQR-QGMVGG-PmngqLNG--------A-QMGHHQmtsgnmmyngqpqqqqqhhhpqqqqqqhhmhpqqhqq 125 southern platyfish
XP_004044806  95 -----------NSQFMG--PPVASQggSLPASMQLQKLNNQYFNhHPyphnh--ympdLHPAAGHQMNGTNqHFRDCNPK 159 western lowland...
Q1L8S4       107 qhhhmhpqnqhPQQYMGsgGLSASQ--QLMASMHLQKLNTPYHG-HP-----------LGPMNGHHMGNV--QHRMGPAQ 170 zebrafish
XP_006631309 112 hhpmhpqqqapqQQYMG--GGLTSQ--QLMASMHLQKLNTQYHG-HP-----------FMVMNGNHMGNGP-QYRMGSGQ 174 spotted gar
XP_015194522 102 -----------SSQYVG--PAVSTQg-QLAASMQLQKLNTQYYThHPhpshh-hymsdLHSSN-HQMNGTGqQFRDCNPK 165 spotted gar
Q6NX30        90 -----------NSPFMG---PVPNQgaQLTASMQLQKLNNQYFThHPyphnh--yipeLHPA--NQINGTNqHFRDCNPK 151 tropical clawed...
Q9DDW4        96 -----------GSQFMA--APVGSPggQLSASMQLQKLNNQYFShHPyphgh--yvpdLHPGG-HPLSGGGqHFRDCNPK 159 chicken
XP_016850503  94 -----------NSQFMA--PTVAPQagPLTASMQLQKLNNQYFShHPyphnh--ympdMHPAS-HQLNGANqHFRDCNPK 157 green anole
NP_001006045  87 -----------NSQFVG-------QgqQLAASMQLQKLNTPYYGhHThpshhhhymheLHPAS-HQLNGTGqQFRDSIAK 147 zebrafish
XP_008275622 117 qhqqqaqhpqqqQQFMN--GGLTSQ--QLMASMQLQKLNTQYHG-HP-----------LGPMGGNHMGPTA-QYRMNPAQ 179 bicolor damselfish
XP_005795999 126 qaphpqqqqqqqQQFMN--GGLTSQ--QLMASMHLQKLNTQYHG-HP-----------LGPMGGNHMGPTN-QYRMNPAQ 188 southern platyfish
XP_004044806 160 HSGGSstpggsggsstpggsggssgggagssnsgggsggsgssnmpasvaHVPAAmLPPNVIDTDFIDEEVLMSLVIEMG 239 western lowland...
Q1L8S4       171 LAGMQm--------------------------------------------GMGGPaLGHNVMDIDLIDEEVLTSLVLELG 206 zebrafish
XP_006631309 175 LAGMQ---------------------------------------------HMGGPpLGLNVADTDFIDEEVLTSLVLELG 209 spotted gar
XP_015194522 166 HSTSSmpp---------------------------------------pahHVPAAiLPPNVIDTDFIDEEVLMSLVIEMG 206 spotted gar
Q6NX30       152 HSTGmpp----------------------------------------svsHVPAAmLPPSVIDTDFIDEEVLMSLVIEMG 191 tropical clawed...
Q9DDW4       160 HGGGGsglp-------------------------------------pavpHVPAAmLPPNVIDTDFIDEEVLMSLVIEMG 202 chicken
XP_016850503 158 HSNTSgstssga--------------------------------vptsvpHVPAAmLPPNVIDTDFIDEEVLMSLVVEMG 205 green anole
NP_001006045 148 QNTSGvpl---------------------------------------pghHMPAAmLPPNVIDTDFIDEEVLMSLVIEMG 188 zebrafish
XP_008275622 180 LANMQ---------------------------------------------HMAGPtLALNGMDADMIDEDVLTSLVMELG 214 bicolor damselfish
XP_005795999 189 LASMQ---------------------------------------------HMAGPaLALNGMDADMIDEDVLTSLVMELG 223 southern platyfish
XP_004044806 240 LDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC 273 western lowland gorilla
Q1L8S4       207 LDRVQELPELFLGQNEFDFFSDFVCKQQPSTVSC 240 zebrafish
XP_006631309 210 LDRIQELPELFLGQNEFDFISDFVSKQQPSTVSC 243 spotted gar
XP_015194522 207 LDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC 240 spotted gar
Q6NX30       192 LDRIKELPELWLGQNEFDFMTDFVCKQQPNRVSC 225 tropical clawed frog
Q9DDW4       203 LDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC 236 chicken
XP_016850503 206 LDRIKELPELWLGQNEFDFMTDFVCKQQSSRVSC 239 green anole
NP_001006045 189 LDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC 222 zebrafish
XP_008275622 215 LDRVQELPELFLGQNEFDFISDFVSKQQPSTVSC 248 bicolor damselfish
XP_005795999 224 LDRVQELPELFLGQNEFDFISDFVSKQQPSTVSC 257 southern platyfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap