3CS5


Conserved Protein Domain Family
NblA

?
pfam04485: NblA 
Click on image for an interactive view with Cn3D
Phycobilisome degradation protein nblA
In the cyanobacterium Synechococcus PCC 7942, nblA triggers degradation of light-harvesting phycobiliproteins in response to deprivation nutrients including nitrogen, phosphorus and sulphur. The mechanism of nblA function is not known, but it has been hypothesized that nblA may act by disrupting phycobilisome structure, activating a protease or tagging phycobiliproteins for proteolysis. Members of this family have also been identified in the chloroplasts of some red algae.
Statistics
?
PSSM-Id: 398271
Aligned: 54 rows
Threshold Bit Score: 42.1623
Threshold Setting Gi: 171696470
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3CS5_C             9 SLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQG 58  Synechococcus elongatus PCC 7942 = FACHB-805
jgi:Cyan7425_0220 11 ELTFEQQFQMRLMEEQVGSMSQQQAKELLLQASKLLMMKDNVIRSLIKKA 60  Cyanothece sp. PCC 7425
Q8DMS8            11 DLSVEQQFQMRVMEAQVSAMSLQEARELLLQASRLLMMKDNVIRSLVKRA 60  Synechococcus elongatus
WP_015173369       7 ELTLEQQFQMRLMEESAQRMSYEQAQELLVQATRLLMMKENIIKSLIRKA 56  Geitlerinema sp. PCC 7407
jgi:GEI7407_3339   7 DLSLEQQFEMQRVRTDAQSMSHDQVLENLLEVSRLIMLKDNLIRDLMRRS 56  Geitlerinema sp. PCC 7407
P73891             7 DLTIEQMFEFRRMQDATANISQEQALELLVQASRLLMIKSNVIRDLMRQA 56  Synechocystis sp. PCC 6803 substr. Kazusa
jgi:Sta7437_0830  14 NLTLEQKLQMRLFQDSAENMNREQALSLLLEASRLLMIKDNIIRDLIKQN 63  Stanieria cyanosphaera PCC 7437
WP_012628244       8 QLTLEQKFQLQVIESEVATMNREKLIELVIKTSQLLMIKENAIRSLARKv 57  Cyanothece sp. PCC 7425
jgi:Ple7327_2605  11 ELTLEQQFQMRLMEQSAQEMSREQAISLLLETARLLMMKDNAIRLLVKQi 60  Pleurocapsa sp. PCC 7327
WP_015144646       7 ELTLEQEFQLRLMEESVQEMSREQMQDLLIQTARLLMVKDNVLRQTIKNc 56  Pleurocapsales
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap