Conserved Protein Domain Family
QWRF

?
pfam04484: QWRF 
QWRF family
AUG8 belongs to the plant QWRF motif-containing protein family, which also includes microtubule-associated protein ENDOSPERM DEFECTIVE 1 and SNOWY COTYLEDON 3. AUG8 binds the microtubule plus-end and participates in the reorientation of microtubules in hypocotyls (the stem of a germinating seedling).
Statistics
?
PSSM-Id: 398270
Aligned: 35 rows
Threshold Bit Score: 197.567
Threshold Setting Gi: 241918808
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERM93929     302 SVSSGSNSgvhesigiskgRsT--PRG-IAVP--ARFLQE-TNNRIRRtnslgssFQEPTSPLDHqskrrdpnsplagsr 375 Amborella trich...
EES04044     136 STSGPAAPt--------------aRRGyPRLPtpARAGSCpASAAV---------ESDTASCCSSs-------------- 178 sorghum
Q8S8I1       146 SLSTNRSSw--------------nHKPgIKVS--SKYLHDlTAKPSKGnnktklrSQDDSQRTNSs-------------- 195 thale cress
EEF44501     232 STATGKNS----------------RKSgIEVS--SKYLQH-IPSRCRRgts-dsnIQHPISLDASp-------------- 277 castor bean
KRH22442     140 SRRHSRNSleld---sdagKkLtsKKAdLEV---AKSDATtTPRRARRgtsdsnvANLNGDSSSSv-------------- 199 soybean
XP_002273081 229 dfGSSVSS----------------RKSgIEVS--SKYLND-ASTKPRRwpsdsniNINPASTDNNs-------------- 275 wine grape
EER91952       8 gtrtSASS--------------------------RRPC---TSASPRR----------PSTAAAAsragsgafaydgmra 48  sorghum
XP_015614017   3 SNGVGGGA--------------------------ARPL-----TASRR-------LLARSASTTAsraggagafvydgmr 44  Japanese rice
Q1PE51        39 TSSSSSSS---------------------PSNssKRVMITrSQSTTRSsrpigssDSKSGENIIParnsasrsqei---- 93  thale cress
EEF51575      25 SGAENNST---------------------SINtsRRF-TSrSKSTTRS-------RNTPNEQNISlnsslkpqkksas-- 73  castor bean
ERM93929     376 al-----------gyqpprlvssrkgilvNSSDS-PSSSPRTinrALA---------SPMR--G------PH-HPVSPSK 425 Amborella trich...
EES04044     179 -----------------------------DTSSTaTDLSEADralGMApalscesppLLGPasCrggrlsSElRSSVPES 229 sorghum
Q8S8I1       196 ----------------------------------kGIENRLQrnnSVSryg----------------ssmSQ-WALSPGR 224 thale cress
EEF44501     278 ------------------------------KMKKlTIKNAIKranSLTgyg----------------satSQ-WALSPGR 310 castor bean
KRH22442     200 -------------------------------LKRfTLKTAIRranSLA---------------GtyksskTS-WALSPGR 232 soybean
XP_002273081 276 -----------------------------PRLKKfTIQNAIKranSLTgyg----------------raaSQ-WALSPGR 309 wine grape
EER91952      49 tplststanftrslrkavsfahnhkkpppSAADA-----PAPp---------------------------PR-RALSSKE 95  sorghum
XP_015614017  45 paplfsstnfarslrkaasfggggkkqysADDDGaVAVKAAAp---------------------------PR-RALSSKE 96  Japanese rice
Q1PE51        94 -------------------nngrsresfaRYLEQrTRGSPRSnasSRGv--------------KpgasspSA-WALSPGR 139 thale cress
EEF51575      74 -----------------nqdncssrdgsvRFLQRgSASNSPApnyKMP---------------KsasrspSA-WALSPGR 120 castor bean
ERM93929     426 LSG------------------ASPSPSRGI-SPLRSRGATPMHfslg-ssvSSCSSSSSSIlnff---advrKGKKGANQ 482 Amborella trich...
EES04044     230 GGSsrasnplcyrslnsalsiSTAMAGK-LtAAGRPPQPQGPK--------AADLKRAAIV-----------GGRKVAGK 289 sorghum
Q8S8I1       225 ----------------------------SLdTQAVTVPSSKLK--------PPRGKGVGKLinlg---fdffRSKNKSSP 265 thale cress
EEF44501     311 SGS----------------------PPMSVeNKERPLSFSSLKpps--spsRSSAKGVEKLlnlg---ldlfKSKKWPSS 363 castor bean
KRH22442     233 SES----------------------PAMSVeSMDKAVSFSSFKvpp---tsPTKVKGVEKLlnmg---fdlfKGKKSGGF 284 soybean
XP_002273081 310 AGS----------------------QPMTVeNKGIPMSFSSLKpp----tsPSRTKGVGNFlslg---lelfKSKKSSPS 360 wine grape
EER91952      96 NSAastteavlmsphrrsmpePG-AAASGPwEPTTRRRRSTgtv----deaAGAGKGSSSSsgallretmspRRKEEPEK 170 sorghum
XP_015614017  97 NTVh----------------eLGTAAARGPwEPARRPRRSSSGgsss-penAGSTRGSAVlrd------mmtRRKEEPEK 153 Japanese rice
Q1PE51       140 LSTmktp-----------lssSAPTTSMCMtPPESPVSKAKIR--------SGGGGAVAGVlky-----fmaQKKVSPVQ 195 thale cress
EEF51575     121 SLF------------------------NVLpQAELPVISSSSGeergkkvkSGSGGAISGVlry------frQKKASSVQ 170 castor bean
ERM93929     483 -----------IEDAHLLRLFYNRHLQWRFVNARAEAALSTQTVLAEKLLYNAWLTTSELRDSVTLRRIGLQQMRQKTKL 551 Amborella trich...
EES04044     290 -----------QEDVHQLRLMDNSYLQYRFLNARAEAAGKAKAAAAEKSLYGLEERIASLRVSVAEKRAEMEMMKRQHTL 358 sorghum
Q8S8I1       266 ftsplkpktcdTESAHQLKLMNNRLLQWRFVNARACDVNKNVASQEKNQLLCAWDTLIKLNNLVLQERIKLQKKNLEMKL 345 thale cress
EEF44501     364 sslta--gsgnVQSIHQLRMLHNQQMQWRYANARADGVYGNVTKQVENNLLCAWHSLANLQRSVLLKKLQLQKEKFEIKL 441 castor bean
KRH22442     285 gslspvgfgvhSEVVHRLRLLDNRLVQWRFANARAQVVNGNTSHKAQSNLICVWDGLTKLQQSVLKKKIQFVREKLEMKI 364 soybean
XP_002273081 361 tgss---lagnTETVHQFRLLHNRLLQWRFVNARADSVNQNITNQTQSNLIYALDSLTQLQHSVVQKKLQLARENLEMKL 437 wine grape
EER91952     171 -----------DEAAHRARMLTARLLQWRFANARMEKAMARATSAAENKLFYTWLRVAELRNIQAAKRIVAQRRRQKLKL 239 sorghum
XP_015614017 154 -----------EEAAHRARMLAARLLQWRFANARMEKAMARATAAAENKLFYTWLRVAELRNIQAAKRIVAQRRRQKLKL 222 Japanese rice
Q1PE51       196 -----------EEDYHRFRIFQNRLLQWRFVNARTEATMANLKINVEDQLFWVWLRIYKMRNYVVENLIEIQRLRQDIKV 264 thale cress
EEF51575     171 -----------EEECRRFRVLHNRILQWRFANAKADAAMASTKIIAENKLFHVWLRILNVRTIILEKRIQILKLKQEVKL 239 castor bean
ERM93929     552 IFILKGHMSYLEDWSLLERDHSNSLSGAIEALKASTLRLPVIDGARA-DIHEMRDAVGSAVDVMQAMGSSICNLLSR-VE 629 Amborella trich...
EES04044     359 NSVVNAQVPYLIQWGEIEGDHASCLRGATTALSNASLRLPIIGSVNA-NCEELTEVLKSAAQLLEPLSPCIENFLPK-VE 436 sorghum
Q8S8I1       346 NYVFLSQVKHLEAWEDMEIQHLSSLSIIRDSLHSVLSRLPLKEGAKV-NLESAVSIIKNAEAVTDAIISTVDDYAPT-ME 423 thale cress
EEF44501     442 DFILHSQIKQLEAWGDMERQHLSAVLKTKECLYSVICKVPLIEGAKA-EPQSTSLALRHASDLAASIKSTLITFSPL-TE 519 castor bean
KRH22442     365 AFVLYSQMKLLEAWGGMERQHLLAITAIKECLHSVVCRVPILEGAKV-NMQPTSIALRHASDLTVSIKSILTTFSSSeVD 443 soybean
XP_002273081 438 NFILHSQIRPLEAWGDMERQHLSAVSVTKDCLNSVVCRVPLIEGAEV-NSQSASLALCHALDLAASIKSMLATFSSS-AG 515 wine grape
EER91952     240 ARLLRPQLPLLASWEPLAKPHADATADLGRVLSAACTGVPLAAGARAdDMDALHETMFSCVGTVNEIEAITDTFYAT-AG 318 sorghum
XP_015614017 223 ARLLRPQLSLLASWDSLAKPHADAVDDLGAVLAAACTALPLADGAQG-DMESLHEAMFACVGTVNDIEANADMFFAT-AG 300 Japanese rice
Q1PE51       265 REVLSLQMPLLNEWSKIDAKNSEALSKLTRKLHALSVRLPLVHGATI-DMVSIHEEMVIAIEVMDEIEDVIIKFLPR-VE 342 thale cress
EEF51575     240 FEIVNPQMHFLNDWAKIERKNYEAVGRMTRKLSALSVKLPLVEEATG-DVESILKAMSTAAEVMDSIEATITKFFPQ-VE 317 castor bean
ERM93929     630 DMNSLVSELADVAAQEKALL 649 Amborella trichopoda
EES04044     437 QIDDVASNLAQVIATERTLI 456 sorghum
Q8S8I1       424 GIVPLASQLAEVVVQEKLML 443 thale cress
EEF44501     520 KGAAFFSQLAEVVSQEKLLL 539 castor bean
KRH22442     444 KISAMLSELAKVVAREKQLL 463 soybean
XP_002273081 516 NTFSLLWELAEVVAQEKSHL 535 wine grape
EER91952     319 ATSGALEELARTIQQEMECL 338 sorghum
XP_015614017 301 VTSSTLEELSTTIKQEVEGL 320 Japanese rice
Q1PE51       343 IILYELTELIGMFNQEllyf 362 thale cress
EEF51575     318 KILYLLTELTSTLEhqkdsl 337 castor bean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap