Conserved Protein Domain Family
DUF561

?
pfam04481: DUF561 
Protein of unknown function (DUF561)
Protein of unknown function found in a cyanobacterium, and the chloroplasts of algae.
Statistics
?
PSSM-Id: 113257
View PSSM: pfam04481
Aligned: 5 rows
Threshold Bit Score: 333.256
Threshold Setting Gi: 401515
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P46314   3 LRNn--K--LHSSFIQRKAIKVISGINNFNVGQIFKIIHACEISKATYVDVARNPKIVSFIK-SISSIPVCVSSIDPRAL 77  Antithamnion sp.
P73066   1 MSAnlaQ--LHQALENRTALKVISGLNNFDSANVLAVARAAQAGGATFVDIAADRQLIQQVR-HAIDLPICVSAVEAELL 77  Synechocystis sp. PCC...
P51373   3 ISS---K--ISSDFDKQSALKVITGLNNFNIPQIKQMALASEIAKVTYLDIVADTDIIKEVE-SVSKIPICVSAVKSKEL 76  Porphyra purpurea
O19904   1 MVN---KsqVLLDIANKKAIKVISGLTNLNYEHVLTIARASQRACVSYIDIAADPQLVKVVK-ANVNIPICVSGLEIQPI 76  Cyanidium caldarium
P31605   1 MNN---K--IDNFLKQKKLIKVISGLNNFNTTHVIKIAKAASKTNASFIDIAAAPKLVEKVKkEVPNLPICVSAIKPELF 75  Cyanophora paradoxa
P46314  78 YESVLAGADLVEIGNFDCFYTNGVYLSNDQIIAIVKQVKYLLPYTDICVTIPHILKLHEQIYLAQKLESLGINLLQTEGS 157 Antithamnion sp.
P73066  78 AEAVAAGADLVEIGNFDSFYAQGRRFEGPEVLALTKATRQLLPHTLLSVTVPHILALDEQVQLAEALVAAGADIIQTEGG 157 Synechocystis sp. PCC...
P51373  77 LKCQKTGVNILEIGNYDCFYEQGRLFHSEEIKLISKETRNLLPHATLCVTLPHILKIEEQVKLASDLQRIGIDMIQTEGK 156 Porphyra purpurea
O19904  77 YNAVLAGADLIEVGNYESLYKRNTVLSVCKIITLVEEIKKLCPRVPLTVTIPYILNQKDQINLCKQLESLRVDYIQTEG- 155 Cyanidium caldarium
P31605  76 VPCVKAGAELIEIGNFDSLYNQGYKINFSDVLSLVKQTRSLLPDTPLSVTIPYLLPLNLQLELAYRLEDLNVDLIQTEGK 155 Cyanophora paradoxa
P46314 158 ITNFSnekllEAKKINDNILYSTSmaccALSSVYSISKVVSLPVIASSGINGISASVALSYGASGIGIRSSVSKLGNIID 237 Antithamnion sp.
P73066 158 TSAEP-----HHPGVLGLIEKAAP----TLAAAHAISRAVNVPVLCASGLSDVTVPMAIAAGASGVGVGSAINQLNDQVA 228 Synechocystis sp. PCC...
P51373 157 STSIS-----KTDHLSGMIQKSAS----TFSSTYTVSSKIRLPIISASGISSLTSPIAFLYGASGIGIGSNIRRLQDIGS 227 Porphyra purpurea
O19904 156 -NSISk---cKNHCVQDLLRLSLQ----TLACTYELVKHTQLPIICSSGLSDVTVPLAFSLGASGIGIGKFVTSYYEEEK 227 Cyanidium caldarium
P31605 156 INKIT------SLLDNRNIETILP----TLASTYLIANNVTIPVICASGLTISTIELPFKLNASGIGIGNAVSKLNSTEE 225 Cyanophora paradoxa
P46314 238 MSNYIDEMIFSTSKKLYD 255 Antithamnion sp.
P73066 229 MVAAVRRLADALVAQPVR 246 Synechocystis sp. PCC 6803
P51373 228 MVIYIYEVQAAISSNHNI 245 Porphyra purpurea
O19904 228 IVSILSKIKKIVSGTRSY 245 Cyanidium caldarium
P31605 226 MINLLNEISTRINYSTVL 243 Cyanophora paradoxa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap