Conserved Protein Domain Family
Mid2

?
pfam04478: Mid2 
Mid2 like cell wall stress sensor
This family represents a region near the C-terminus of Mid2, which contains a transmembrane region. The remainder of the protein sequence is serine-rich and of low complexity, and is therefore impossible to align accurately. Mid2 is thought to act as a mechanosensor of cell wall stress. The C-terminal cytoplasmic region of Mid2 is known to interact with Rom2, a guanine nucleotide exchange factor (GEF) for Rho1, which is part of the cell wall integrity signalling pathway.
Statistics
?
PSSM-Id: 398266
Aligned: 8 rows
Threshold Bit Score: 147.984
Threshold Setting Gi: 74607836
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P53214   316 AKTI-TSIIEGQTILSNYYTTITYSPTASASSGKN--SHHSGLSKKNRNIIIGCVVGIGAPLILILLILIYMFCVQPKKT 392 Saccharomyces cerev...
CCD24702 293 RKTV-TSIIHGKTILSNYYTTITYTPTATANSSNSk-NSHSGLTKKNRNIVLGCVLGIGIPLLLLIGLILYHFCIKSKST 370 Naumovozyma dairene...
CCC66753 237 QLTV-TSIIHGKTVLSNLYTTVTYMPPDGSTNKN---KTTSGLSKKNRNIVIGCCVGIGVPLLLLILLFLYHYCIKPKQT 312 Naumovozyma castell...
Q6FPX2   263 NVII-TSVIEGKTILSNSYTTITYSPESTAHKSPQnkSGNHGLSSKNKKIVIGCVVGIGVPLLIAILVLLYIFCIMPTRT 341 [Candida] glabrata
CCE65267 175 rATL-TTVINGSTILSDIYVTLSATATASANNNNTnaNNHSGLSKKNRNIVIGCVVGIGVPVLLALLIIFYIFCIQSKKT 253 Tetrapisispora phaf...
Q758Q5   270 GSTFrTTSLKIVTLLVDGSSTLTITASESQTT-----APSRGLSKKDKNIIIGCVVGICVPLLIVIACVVFYTCVREDRT 344 Eremothecium gossypii
Q6CY50   169 PTTI-TSVINGVTILSDRYTTVTFTPTSTSDPDSRe-GQHTGLSDKNKRIVIGVVVGLGVPILLVLLALIYIFCIKPKRT 246 Kluyveromyces lactis
Q6FTP5   167 NPTI-TSIIEGKTILSDLYTTITYTPTATHGANNK--KVHHGLSKKNRNIVIGCVVGIGVPLIVLTLFLLYVFCIRSPKT 243 [Candida] glabrata
P53214   393 DFIDSDGKIVTAYRSNIFTKIWYFLLGKKIgeTERFSSDSPIGs---nNIQNFGDIDPEDILNNDNPYTPKHTNVEG 466 Saccharomyces cerevisi...
CCD24702 371 NFIDSDGKVITAYKTNNLHKLWNLLIGKKNn-NEEYHSNLPLG-----SRNNDGGENGYNFDNDDILVQRNIRNDDG 441 Naumovozyma dairenensi...
CCC66753 313 NFIDSDGKVITAYKTNNLQRFFNSLIGKNKn-TEQYQTKSPLGntivtSMNNN------KIQNNDVTANTN----DG 378 Naumovozyma castellii ...
Q6FPX2   342 DFIDSDGKVITAYKRNIFVTIWYSLLGKNLddARNFSSESPMG-------SDDNSSDFIITNDKDVANTYEVPDIDT 411 [Candida] glabrata
CCE65267 254 DFINSDGQVVTAYSANKFTAWWYNLLGKDT--SEKYETKSPLGg---sSSDLDEQLNDRSSLNNDDSLDllvtrdef 325 Tetrapisispora phaffii...
Q758Q5   345 NFINSDGKVITAYSTSRLSKWWSTLLGRKI---DKYESDTPLGs---tPLHDDERIHL-KSSSAHHSSPLSMHGLDS 414 Eremothecium gossypii
Q6CY50   247 NFLNSEGKVVTAYTSGKVSKWWKAFMGKQT---DDYVTESP-------ESGIDEPSVLAPTRN----NTVGRNNTDG 309 Kluyveromyces lactis
Q6FTP5   244 DFINSDGKVITAYRPNKITKWWNALMGREI--TEEYQSKSPLGg----EASDFEDSELAYADDDDESLSYGASNMDS 314 [Candida] glabrata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap