1J27


Conserved Protein Domain Family
DUF503

?
pfam04456: DUF503 
Protein of unknown function (DUF503)
Family of hypothetical bacterial proteins.
Statistics
?
PSSM-Id: 398253
Aligned: 207 rows
Threshold Bit Score: 68.2147
Threshold Setting Gi: 502633164
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1J27_A               6 GLYTARLETP-ARSLKEKRALIKPALERLKARFPVSAARLYGLDAWGYEVVGFTLLGNDPAWVEETMRAAARFLAEAGGF 84 
gigasnome:DGI_1558   4 GTLLLEFTLHgNDSLKGKRNVAQSLKRKLRNKFNVAVAEVDSMESHTRLVLACVTVSNDAAHAQGLLTKVQNMVEAATDE 83  Desulfovi...
WP_015774583         4 GTLRLEFRLHgVFSLKEKRKSANSLKQKLRNTFNVSVAETEAQDSHQVLVLGVVTVSNDTAHVHSRLSKVLAMVEASTAD 83  Desulfomi...
jgi:Dret_0494        4 GLLSIEFYLHgIGSLKDKRRIANSLKQKLRNKFNVAVAEIDTQHSHTWLKLEILTLANERARVESVLNKALAMVEAISDE 83  Desulfoha...
jgi:Daes_2146        1 --MTLEFRLHgNRSLKEKRRVAQSLKQKLRNTFNVAVAEVEAMDAHDRLVLGVVTTANRTDRVESRLAKALAMTEAITPV 78  Pseudodes...
WP_015850885         4 GVLSLEFRLHgNRSLKGKRKVSLSLKQKLRNKFNLSVSEVEAMDSHERLILAAVTVANETRKVESTLSKALAMIEAMAPA 83  Desulfovi...
WP_014320691         4 GVLHLEFRLHgNRSLKDKRKVSLSLKQKLRNKFNVSVAEVDALDVHDKLVLAVVTTANESGRVESTLSKALAMVEAISPA 83  Desulfovi...
WP_014872855        23 GVLTLHFQLYaCDDLKAKRKVFAPLKTIWGKEPDLAVAETDHQDILDCATWTVVALGSSSQQISQRLDQVEKAINERIDA 102 Marinobac...
Q2SN92               4 FVVRIEFQLQgCASLKEKRQRTSGVREKLGRQPHLAIIESGQADALQTGEWTIILLAPNRATADKHLSQLEQTLAQNLDA 83  Hahella c...
Q4FR20               4 AILTLTFSLPgCGSLKEKRQRMVGLHARFGNTPSVAVCESGERDRHDASEWTLVVVGLSKREVESLCSQIEDKIERTVDA 83  Psychroba...
1J27_A              85 QV 86 
gigasnome:DGI_1558  84 EL 85  Desulfovibrio gigas DSM 1382 = ATCC 19364
WP_015774583        84 EL 85  Desulfomicrobium baculatum
jgi:Dret_0494       84 EI 85  Desulfohalobium retbaense DSM 5692
jgi:Daes_2146       79 EL 80  Pseudodesulfovibrio aespoeensis Aspo-2
WP_015850885        84 EL 85  Desulfovibrio salexigens
WP_014320691        84 EL 85  Desulfovibrio desulfuricans
WP_014872855       103 AI 104 Marinobacter sp. BSs20148
Q2SN92              84 RI 85  Hahella chejuensis KCTC 2396
Q4FR20              84 RV 85  Psychrobacter arcticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap