3DKT


Conserved Protein Domain Family
Linocin_M18

?
pfam04454: Linocin_M18 
Click on image for an interactive view with Cn3D
Encapsulating protein for peroxidase
The Linocin_M18 is found in eubacteria and archaea. These proteins, referred to as encapsulins, form nanocompartments within the bacterium which contain ferritin-like proteins or peroxidases, enzymes involved in oxidative-stress response. These enzymes are targeted to the interior of encapsulins via unique C-terminal extensions.
Statistics
?
PSSM-Id: 398251
Aligned: 35 rows
Threshold Bit Score: 194.742
Threshold Setting Gi: 123497228
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3DKT_E          1 ME-FLKRSFAPLTEKQWQEIDNRAREIFKTQLYGRKFVDVEGPYGWEYAAHPLGEVEVLSDENEV------------VKW 67  Thermotoga mar...
Q08WR7          2 PD-FLGHAENPLREEEWARLNETVIQVARRSLVGRRILDIYGPLGAGVQSVPHDEYQGVSSGAIDivgeq---etatVFT 77  Stigmatella au...
jgi:Mboo_1095   2 ANvYLGRDEAPIGAESWKLIDDVAVQAAKGQLAGRRLLAIEGPYGFGLKAIPLGDYALED------------------GI 63  Methanoregula ...
WP_012617936    5 S--YLGRSDAPITAETWTIIDTTMVEAAKSMLTGRRLLHLEGPYGLGLKAIPLQDSVSEG------------------NL 64  Methanosphaeru...
O67639          1 ME-FLQRDQAPLTAEEWEQIDKTAYEVFKSTVVCRKFMPVVGPFGAGHQVVSYDVLYGVEPGVCEvkpgqeykvcepVRT 79  Aquifex aeolicus
jgi:Elen_3018   1 MD-YLARESADLSDGLWNRIDETVIGTARAQLTCRRFLKVFGPLGAGVTTVAVDGVNKEEVLEDGi-----------GRI 68  Eggerthella le...
WP_004463878    1 MD-FLSREGSPISAELWEKIDEAVVSAAKKILTGRRFISIYGPLGAGIQAINVDNISELDETEENi-----------SVI 68  Hungateiclostr...
WP_007721249    1 MDkLRKYPDSPLTTEEWNQLDATVVDMARRQLVGRRFIDIYGPLGEGIQTITNDVYEESRFGGLSlrge----slemTQP 76  Bacillales
Q5L1H9          1 mdktklyPEAPLTSSQWGELDELVIETARRQLVGRRFIDLYGPLGEGVQSVANDIYMNPEQGDMSfhgk----elslSEP 76  Geobacillus ka...
WP_012514357    1 MN-FLHREESPLTAQEWQTIDNIVVNTARNHLVGRRFIELTQALDPAIQSVAYDTIPSLDNGACGlfgdk---ecgiAKI 76  Hydrogenobacul...
3DKT_E         68 GLRKSLPLIELRATFTLDLWELDNLERGKPNVDLSSLEETVRKVAEFEDEVIFRGCEKSGVKGLLSFEE-RKIECG--ST 144 Thermotoga mar...
Q08WR7         78 DVRKFKTIPIIYKDFLLHWRDIEAARIHNMPLDVSAAAGAAALCAQQEDELIFYGDPKLGHEGLMTATDrLTVPLGdwAT 157 Stigmatella au...
jgi:Mboo_1095  64 SASVSLPLSLIRTEFSLGKRDLAAYERDHLILDTAPVACAAMDAAAKEDRIIFNGLA--GTPGLLNAEGaGSLTLSkwDK 141 Methanoregula ...
WP_012617936   65 IRSGFAPVDLIQTSFSLSKRDLAAYERDGMLPNTSAVAVAAIEAARQEDAVIFTGTD--QVKGLMNTGGsQSVKLAswEK 142 Methanosphaeru...
O67639         80 GERKHVPVPTLYKDFVISWRDLEHWRQFNLPVDTTGVAAAASSLAVAEDKLILFGNQEMGIEGFLTAKGtLREELSdwEK 159 Aquifex aeolicus
jgi:Elen_3018  69 VGRTQLELPLFYEDFTLLSRDMEYAAQTGYPLDLSVAIAAAKKASRREDDLILNGSKALGTDGLLTVKGsSKIKKSdwSQ 148 Eggerthella le...
WP_004463878   69 RGRTYRHIPLINEDFSLLWRDLEFSEQMGLPVDLSSASRAATQCALREDKLIFYGNDELGYKGLLTEDGiVKFPISnwSE 148 Hungateiclostr...
WP_007721249   77 SRRVSMTIPILYKDFMLYWRDVAQARTLGMPLDMSAAANAAAGGALMEDDLIFNGAAEFDLPGLMNVKGrLTHLKSdwME 156 Bacillales
Q5L1H9         77 ARRVHLTIPLLYKDFILYWRDIEQAKQLGSPIDFSAAANAAQQCALLEDDLIFNGSTEFDVPGIMNVKGkIAHIRSdwMK 156 Geobacillus ka...
WP_012514357   77 KSRKFLPIPQIYKDFKIHWRDIETSRKLNIPLDVSVVALATREVALAEDRFIFHGDSEIGYPGLLNVEGrSIIKNKnfDE 156 Hydrogenobacul...
3DKT_E        145 PKDLLEAIVRALSIFSKDGIEGPYTLVINTDRWINFLKEEAG-HYPLEKRVEECLrGGKIITTPRIED--ALVVSERGGD 221 Thermotoga mar...
Q08WR7        158 PGAGYVAIVEATRKLNEHGHYGPYAVVLSPRLYSLLHRIFEKtGVLEIETIRQLA-SDGVFQSNRLRGdsGVVVSTGREN 236 Stigmatella au...
jgi:Mboo_1095 142 VGAAADQIIDAVTKLDAAGFHGPYSLALAPAQYNLLLRRYPQgDGTELDHVSSIV-GDGVIKAPVLKKg-GVLVASGSQY 219 Methanoregula ...
WP_012617936  143 IGAAADDLIKAVTALDLAGFHGPYALALSPARYNLLFRRYPQgSTTELEHLQQMI-TDGIFKAPVLKDg-GVLIATGQQY 220 Methanosphaeru...
O67639        160 VGNAFQDVVKGISRLVEKGFYTNYYLIVNPKRYFLLNRIHDNtGLLELEQIKKVV--KEVYQTPIIPEdiVLLVSASPAN 237 Aquifex aeolicus
jgi:Elen_3018 149 GENSFADITAGVAQLAKTGYLGRYALVVSPDLFLDLQRLQPNtGLLEIDRIKKLI-GDNVYMTSVMGPgkAVLVCAEPEY 227 Eggerthella le...
WP_004463878  149 GENPFKDISIGLAKFIENGIVGRKALVVSPNLFVQLQRIQPGtGTTEYDRINKLL-DGNIFSTPVLKDdkAVLVCSEPQN 227 Hungateiclostr...
WP_007721249  157 SGNAFADIVEARNKLLKMGHSGPYALVVSPELYSLLHRVHKGtNVLEIEHVRNLV-TDGVFQSPTIKGrsGVLVATGRHN 235 Bacillales
Q5L1H9        157 SGNAFTDVVEARNKLLQLGHTGPYALVLSPELYALIHRVHEGtHVLEIEHIRELM-TAGIYQTPVIKGkrGVVIDTGRQN 235 Geobacillus ka...
WP_012514357  157 EGGIFKTALACVETLVEKGFSKNLAYILNPKDYTKAFRIYGNsGVLEITHIKELF-DVGVFTSHAVDEgkTIAVATGVEN 235 Hydrogenobacul...
3DKT_E        222 FKLILGQDLSIGYEDREKDAVRLFITETFT 251 Thermotoga maritima
Q08WR7        237 MDLTVAMDMVTAYLGASRMNHPFRVLEALI 266 Stigmatella aurantiaca DW4/3-1
jgi:Mboo_1095 220 ASVALGQDLAVGYNGPVGDLLEFQIYESLA 249 Methanoregula boonei 6A8
WP_012617936  221 AAIVLGQDMTIGFTGPSKESLDFTISESLA 250 Methanosphaerula palustris
O67639        238 FDLAIALDVNVAFVETSNMNHTFRVMEMVV 267 Aquifex aeolicus
jgi:Elen_3018 228 LDLAIGLDLSVGYLELADFNHTFRIMETAA 257 Eggerthella lenta DSM 2243
WP_004463878  228 IDLVIGQDMITSYLETKNLNHYFRIMETIL 257 Hungateiclostridium thermocellum
WP_007721249  236 LDLAIAEDFDSAFLGDEQMNSLFRVYECVV 265 Bacillales
Q5L1H9        236 IDLAVAVDVQTAFLDTENMNYLFRVYESVv 265 Geobacillus kaustophilus
WP_012514357  236 MDIFLVQDMISAFIDYENMDYYFRVFEILA 265 Hydrogenobaculum sp. Y04AAS1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap