1M4X


Conserved Protein Domain Family
Capsid_NCLDV

?
pfam04451: Capsid_NCLDV 
Click on image for an interactive view with Cn3D
Large eukaryotic DNA virus major capsid protein
This family includes the major capsid protein of iridoviruses, chlorella virus and Spodoptera ascovirus, which are all dsDNA viruses with no RNA stage. This is the most abundant structural protein and can account for up to 45% of virion protein. In Chlorella virus PBCV-1 the major capsid protein is a glycoprotein. The four families of large eukaryotic DNA viruses, Poxviridae, Asfarviridae, Iridoviridae, and Phycodnaviridae, are referred to collectively as nucleocytoplasmic large DNA viruses or NCLDV. The virions of different NCLDV have dramatically different structures. The major capsid proteins of iridoviruses and phycodnaviruses, both of which have icosahedral capsids surrounding an inner lipid membrane, showed a high level of sequence conservation. A more limited, but statistically significant sequence similarity was observed between these proteins and the major capsid protein (p72) of ASFV, which also has an icosahedral capsid. It was surprising, however, to find that all of these proteins shared a conserved domain with the poxvirus protein D13L, which is an integral virion component thought to form a scaffold for the formation of viral crescents and immature virion.
Statistics
?
PSSM-Id: 398248
Aligned: 17 rows
Threshold Bit Score: 122.478
Threshold Setting Gi: 1168988
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1M4X_A    191 ERTRFAQLPHEYLIEQLQFTGSeta--tpSATTQAAQNIRLNFNHPTKYLAWNFNNPTNYGQYTalanipgacsgagtaa 268 Paramecium bursari...
Q7T6X4    402 ERKRFAQSAHEYLIEVVQYQTF-------DNIDHSKYNSHLKFSHPTKYIVWFVQPSHYRENPTgktkcqwn-------- 466 Acanthamoeba polyp...
Q7T6Y5    325 ERMMLIKNPQEYLIEQIQYNQE-------INVKNSNVKQKLTLNHPCKAHYWVVQSDSLVGPGTindvfnftts------ 391 Acanthamoeba polyp...
Q5UQL7    242 ERRRFAQVSHEYLIEQLQFTGEe------SAGSSNSAKYKLNFNHPVKAIYWVTKLGNYQGGKFmtydpvcwenarenaa 315 Acanthamoeba polyp...
O41104    326 ERIRMSEIQHEYLVTQLQWQGSepvtapgDPNGSTNRKITLNFNHPVRELVFVYQAASNYDVDAvtgnnifdyeip---- 401 Paramecium bursari...
NP_612228 251 EREVVAQSSRSMLIEQCQVAPRvp----vTPADNSLVHLDLRFSHPVKALFFAVKNVTHRNVQSnytaaspvyv------ 320 Infectious spleen ...
Q67473    260 ERQAMSSTVRDMVVEQVQAAPVhm----vNPRNATTFHTDMRFSHAVKALMFMVQNVTHPSVGSnytcvtpvvg------ 329 Frog virus 3 (isol...
P22176    255 ERRLMGTTPRDILVEQVQTAPKhv----fQPLTIPSPNFDIRFSHAIKLLFFGVRNTTHAAVQSnyttaspvile----- 325 Lymphocystis disea...
Q197E6    264 ERKKMGCGVRDILIEQVQTAPRqn----yTPSTNPMPSFDIRFSHAVKVLFFAVRNKTSAAEWSnygtsspvvs------ 333 Invertebrate iride...
Q05815    263 ERRRMGCSVRDILVEQVQTAPRhv----wNPTTNDAPNYDIRFSHAIKALFFAVRNTTFSNQPSnyttaspvits----- 333 Invertebrate iride...
1M4X_A        --------------------------------------------------------------------------------     Paramecium bursari...
Q7T6X4        --------------------------------------------------------------------------------     Acanthamoeba polyp...
Q7T6Y5        --------------------------------------------------------------------------------     Acanthamoeba polyp...
Q5UQL7    316 kllllaqydlddwgyfqepggyecegndgrsyvgdcgvqytavdpsnpseepsyifndtttaeafdgslligklapcvpl 395 Acanthamoeba polyp...
O41104        --------------------------------------------------------------------------------     Paramecium bursari...
NP_612228     --------------------------------------------------------------------------------     Infectious spleen ...
Q67473        --------------------------------------------------------------------------------     Frog virus 3 (isol...
P22176        --------------------------------------------------------------------------------     Lymphocystis disea...
Q197E6        --------------------------------------------------------------------------------     Invertebrate iride...
Q05815        --------------------------------------------------------------------------------     Invertebrate iride...
1M4X_A    269 -----------------------------------------------------------------atvttpdygntgtyn 283 Paramecium bursari...
Q7T6X4    467 -------------------------------------------------------------------------nfgtspd 473 Acanthamoeba polyp...
Q7T6Y5    392 -----------------------------------------------------------------------hirnhdgrt 400 Acanthamoeba polyp...
Q5UQL7    396 lkrnkdvdlkdkvegiirihtdfendrmkypevekitrndltlhdlsvpiskydvdnrvdyikkfdvtvwqhnnfgllid 475 Acanthamoeba polyp...
O41104    402 ----------------------------------------------------------------------anptatppya 411 Paramecium bursari...
NP_612228 321 ------------------------------------------------------------------------nnkvnlpl 328 Infectious spleen ...
Q67473    330 -----------------------------------------------------------------------vgntvlepa 338 Frog virus 3 (isol...
P22176    326 -----------------------------------------------------------------------eayasdlsl 334 Lymphocystis disea...
Q197E6    334 -----------------------------------------------------------------------gtsvnyeps 342 Invertebrate iride...
Q05815    334 -----------------------------------------------------------------------ttvilepst 342 Invertebrate iride...
1M4X_A    284 eQLAVLDSAKIQLNGQDRFATRKGS-YFNKVQPYQSIGgVTP--AGVYLYSFAL-KPAGRQPSGTCNFSRIDNATLSLTY 359 Paramecium bursari...
Q7T6X4    474 lTGQPLNNTHLRINSYERTDPNLGVgYYNYVQPYWYFI-STPt-DGLYVYSFSL-KPTEHQPSSTLNLSRIHDFGIYLEF 550 Acanthamoeba polyp...
Q7T6Y5    401 iGENPVTKSKLMLNSRERFKQRDGK-YFNIVQPYQHHY-RGPd-TGINMYSVSI-NSQCHQPSSTINMSRIDDISMEMQL 476 Acanthamoeba polyp...
Q5UQL7    476 gSGNPTHEAELQLNGQPRQSKRGGI-WYDTVNPTVHHT-KSPr-DGVNVFSFAL-NPEEHQPSCTCNFSRIDTAQLNLWF 551 Acanthamoeba polyp...
O41104    412 gGGEVFTEVKLIINGSDRFSGRPGA-YFRLVQPYEHHV-RVPs-KSVYVYSFALeDADSRQPNGSANFTRYDSVQLQLTL 488 Paramecium bursari...
NP_612228 329 mATNPLSEVSLIYENTPRLHQMGVD-YFTSVDPYYFAP-SMPemDGVMTYCYTL-DMGNINPMGSTNYGRLSNVTLSCKV 405 Infectious spleen ...
Q67473    339 lAVDPVKSASLVYENTTRLPDMGVE-YYSLVEPWYYAT-SIPvsTGHHLYSYAL-SLQDPHPSGSTNYGRLTNASLNVTL 415 Frog virus 3 (isol...
P22176    335 vAADPIANVTLVYENSARLNEMGSE-YYSLVQPYYFGG-SIPieTGYHMYCYSL-NMMDMDPMGSTNYGRLSNVSMKLKT 411 Lymphocystis disea...
Q197E6    343 gSFDPIATTTLIYENSNRLGTMGSD-YYSLVSPWYHAP-TIPsfIGYHMYSYSL-NFFDLDPMGSTNYGKLTNVSIVPHA 419 Invertebrate iride...
Q05815    343 gAFDPIHHTTLIYENTNRLNHMGSD-YFSLVNPWYHAP-TIPglTGFHEYSYSL-AFNEIDPMGSTNYGKLTNISIVPTA 419 Invertebrate iride...
1M4X_A    360 KTcsiDATSPAAVlgntetvtantatlltalnIYAKNYNVLRIMSGMGG 408 Paramecium bursaria Chlorella virus 1
Q7T6X4    551 SK---ELSKIIESncss-----------iffgTYIMSYNILRFMSGMAG 585 Acanthamoeba polyphaga mimivirus
Q7T6Y5    477 KN---VNPNNTHKi-----------------rSYTTSYNILRVCFNIGG 505 Acanthamoeba polyphaga mimivirus
Q5UQL7    552 QH---FTNHKFADvfadn---------dnkvlIFAVNYNVLRMLSGMAG 588 Acanthamoeba polyphaga mimivirus
O41104    489 NE---NLASGrv-------------------qIYAPNFNILRIAAGMGG 515 Paramecium bursaria Chlorella virus 1
NP_612228 406 SD---NAKTTAAGgggngsgyt--vaqkfelvVIAVNHNIMKIADGAAG 449 Infectious spleen and kidney necrosis virus
Q67473    416 SA---EATTAAAGgggnnsgyt--taqkyaliVLAINHNIIRIMNGSMG 459 Frog virus 3 (isolate Goorha)
P22176    412 SD---KAVVNAGGgggnmsgyk--daqkfeflTMAINHNVIRIKNGSMG 455 Lymphocystis disease virus 1 (isolate Darai)
Q197E6    420 SD---AA-VKASTgagdgagan--ynqsyefiVMAVNNNIVRISGGCLG 462 Invertebrate iridescent virus 3
Q05815    420 SP---AAKVGAAGtgpagsgqn--fpqtfefiVTALNNNIIRISGGALG 463 Invertebrate iridescent virus 6
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap