1DLM


Conserved Protein Domain Family
Dioxygenase_N

?
pfam04444: Dioxygenase_N 
Click on image for an interactive view with Cn3D
Catechol dioxygenase N-terminus
This family consists of the N termini of catechol, chlorocatechol or hydroxyquinol 1,2-dioxygenase proteins. This region is always found adjacent to the dioxygenase domain (pfam00775).
Statistics
?
PSSM-Id: 398242
Aligned: 108 rows
Threshold Bit Score: 56.7499
Threshold Setting Gi: 374656414
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DLM_A              28 PRVKQIIHRVLSDLYKAIEDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLgFDHYLDMRMDAEDAALG 96  Acinetobacter baylyi
WP_016334341        35 ERVSLLAREVLEAVHGTIRKHKVTYDEYNALKSWLISVGEDGEWPLFLDVW-VEHVVEEVATEHREGNK 102 Amycolatopsis kerati...
WP_014210165        40 ERVNLLAREVLDAVHATIRRHRVSYDEYNALKAWLIGVGADGEWPLFLDVW-VEHVIEDVATDHRAGNk 107 Mycolicibacterium rh...
WP_014182257        44 ERVHILATEMISAVHDIVRRHQVTYEEYNALKSWLISVGRDGEWPLFLDVW-VEHVVEEVATAARQGSK 111 Streptomyces
jgi:Gbro_4154       41 ARVNYLASKVIKGLNEIVLEDKVSYEEYNALKAWLIKVGNDGEWPLFLDVW-LEHSVEEVANEHREGSK 108 Gordonia bronchialis...
jgi:Arth_1933       48 ERVSSLAGRIIKAINDTVLDEKVTYDEYNAFKAWLIQVGEDGEWPLFLDVW-VEHSVEEVANANRHGSK 115 Arthrobacter sp. FB24
jgi:Noca_0836       40 ERVDALAREVLAGIHAAIRKHQVTYAEYNALKAWLIQVGQDGEWPLFLDVF-VEHVVEEVATAHRQGNK 107 Nocardioides sp. JS614
CeBiTec:A605_11120  37 ERANAIYKDLLAAIAEVAHKHQVTYDEYRVLKNWMIQVGEYGEWPLWLDVF-VEHEIEEINYNRNSYTG 104 Corynebacterium halo...
WP_013675211        37 ERVNTVVRAVLDAVHAVIRDHQVTYPEFQAAKRWLMDLGEGGEWPLFLDVF-VEHVVEEVAARSQQGTp 104 Pseudonocardia dioxa...
EHR51247            35 ERIADVVQAVLAGVHEAIRAKQVSYAEFQAAKQWLIEVGEGGEWPLFLDVF-VEHVVEEVTAQRQHGTk 102 Saccharomonospora ma...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap