Conserved Protein Domain Family
Dysbindin

?
pfam04440: Dysbindin 
Dysbindin (Dystrobrevin binding protein 1)
Dysbindin is an evolutionary conserved 40-kDa coiled-coil-containing protein that binds to alpha- and beta-dystrobrevin in muscle and brain. Dystrophin and alpha-dystrobrevin are co-immunoprecipitated with dysbindin, indicating that dysbindin is DPC-associated in muscle. Dysbindin co-localizes with alpha-dystrobrevin at the sarcolemma and is up-regulated in dystrophin-deficient muscle. In the brain, dysbindin is found primarily in axon bundles and especially in certain axon terminals, notably mossy fibre synaptic terminals in the cerebellum and hippocampus. Dysbindin may have implications for the molecular pathology of Duchenne muscular dystrophy and may provide an alternative route for anchoring dystrobrevin and the DPC to the muscle membrane. Genetic variation in the human dysbindin gene is also thought to be associated with Schizophrenia.
Statistics
?
PSSM-Id: 398239
Aligned: 12 rows
Threshold Bit Score: 132.263
Threshold Setting Gi: 551506950
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001336048  17 SEHAQRVPDTEPSQQMRLRERQRFFEEVFQHDVDVYL---SSAHLQI-DYKRPPLGSISSMEVNVDMLEQMDLMDISDQE 92  zebrafish
XP_011513239  19 AEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQYL---STGYLQI-AERREPIGSMSSMEVNVDMLEQMDLMDISDQE 94  human
XP_006517047  19 TEHTQKALEMEHTQQLKLKERQKFFEEAFQQDMEQYL---STGYLQI-AERREPMGSMSSMEVNVDVLEQMDLMDISDQE 94  house mouse
Q2HJA5       175 AEHSQKVLEMEQTQQLKLKERQKFFEEAFQQDMEQYL---STGYLQI-AERREPMGSMSSMEVNVDMLEQMDLMDISDQE 250 cattle
XP_005805006  13 NKDIQKLLKPSSS---GDLSKELFQHPS--GEAEGSLsghTASLLHI-SEKRQPLSSVSSLEVHFDLLDLTELTDMSDQE 86  southern platyfish
XP_001510785  16 AQTAQTTVVVPGH----LGPGEESRAPL--AEEEGGIpipAPGLLQV-TERRQPLSSVSSLEVHFDLLDLTELTDMSDQE 88  platypus
A6H7B4        16 VDMPQAALSAPVP-----VTGTSGQSPM--AEEELGIpipAPGLLQV-TERRQPLSSVSSLEVHFDLLDLTELTDMSDQE 87  cattle
Q9CZ00        16 VKVPQAALNVSAH-----ETGDMCRTPVAEEEEEVGIpipAPGFLQV-TERRQPLSSVSSLEVHFDLLDLTELTDMSDQE 89  house mouse
XP_016287245  94 AEHTQKVLDMEHSQQLKLKERQKFFEEAFQQDMEQYL---STGYLQI-TERREPIGSMSSMEVNVDMLEQMDLMDMTDQE 169 gray short-tail...
XP_005158163  19 AEHAQKVLEMEHAQQVKLKERQKYFEEAFQQDMEQYL---STGYLQI-TDRRDPLGSMSSMEVNVDLLEQMDLTDVSDHE 94  zebrafish
XP_010706624  94 AEHAQKVLDMEHTQQMKLKERQKFFEEAFQQDMEQYL---STGYLQI-AERREPIGSMSSMEVNVDMLEQMDLMDMSDQE 169 turkey
CAF96549      17 AEHGQRPPDVEVAQQLKLRERQRFFEEVFQHDVDVYL---SSAHLCIrDYKRPPIGSISSMEVNVDLLDQMELIDISDQE 93  spotted green p...
XP_001336048  93 ALDVFFAASGEEGSLTSPL-------PDFGHadleenglqRSDLPLRIPDPRE-IKSRMLSTSSNSTCDSQp-------S 157 zebrafish
XP_011513239  95 ALDVFLNSGGEENTVLSPAl-----gPESSTc--------QNEITLQVPNPSE-LRAKPPSSSSTCTDSATr-------D 153 human
XP_006517047  95 ALDVFLNSGGEDNIVMSPGv-----eMESNPn--------QNEMSLQIPSPSE-SASQPPASPSACTDLDT--------- 151 house mouse
Q2HJA5       251 ALDVFLNSGGEENTLLSPIs-----gPEASPg--------QDAVTLQVPTPSQ-APATPPSSSSPGTDPASr-------D 309 cattle
XP_005805006  87 LAEVFADSDEEN-HRESPAgshqpvlPRSGY--------------MRSPSWTRcSKVELPRERKHHSDSDT--------- 142 southern platyfish
XP_001510785  89 LAEVFADSDDENAANESPAglhphpiPRAGY--------------LRSPSWTR-AKAEQNREKKHLSDSEL--------- 144 platypus
A6H7B4        88 LAEVFADSDDENVASDSHAglh--plPRAGC--------------LRSPSWTR-TRAEQNREKQPFGDPER--------- 141 cattle
Q9CZ00        90 LAEVFADSDDENLATESPAglh--plSRASC--------------LRSPSWTK-TRAEQNREKQPPSDPER--------- 143 house mouse
XP_016287245 170 ALDVFLNSGGEDN-VLSPGl-----gPDSSSc--------QNEISLEVPNRSV-SRSKLSSFSSGCADSATq-------E 227 gray short-tail...
XP_005158163  95 ALDVFLSSVGEESSAVSPDaggpslePGSSP----------SDISLKVPSQSE-LRHNISSISSSCTDTVSgttegpdeE 163 zebrafish
XP_010706624 170 ALDVFLNSGGEDNNMLSPMl-----gPDSSTy--------VNEISLQVPSQSE-LRHKLSSLSSTCTDSASq-------E 228 turkey
CAF96549      94 ALDVFFSSSGEEGGLTSPL-------Paqghkk--nedviSNGLFRHVLEGLE-AKSRMSSTSSSSSSDSQ--------T 155 spotted green p...
XP_001336048 158 NEDGSNTPVV 167 zebrafish
XP_011513239 154 ISEGGESPVV 163 human
XP_006517047 152 ----ADAPLI 157 house mouse
Q2HJA5       310 PSEGGESPVV 319 cattle
XP_005805006 143 -----ADPLM 147 southern platyfish
XP_001510785 145 -QAGIVDTFL 153 platypus
A6H7B4       142 -QPAIVDTIL 150 cattle
Q9CZ00       144 -QGTIVDTFL 152 house mouse
XP_016287245 228 NSESGESPVV 237 gray short-tailed opossum
XP_005158163 164 ESSSGDSPLv 173 zebrafish
XP_010706624 229 ASE-GESPVV 237 turkey
CAF96549     156 NTDDTDAPAV 165 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap