Conserved Protein Domain Family
DUF530

?
pfam04409: DUF530 
Protein of unknown function (DUF530)
Family of hypothetical archaeal proteins.
Statistics
?
PSSM-Id: 398215
Aligned: 7 rows
Threshold Bit Score: 458.832
Threshold Setting Gi: 74554597
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2NI37          2 SD--ILVTQSEKFLKTIQSKPVIAESI----EDFDSFIKIYSYLNSNLKQLQNIRNKMEIRGFTSPYSALKRYskgGNSS 75  Methanosphaera...
CDG65178        1 MNesVLIGKSERFLDQIKRKEISLTDI----VSPEKFLSLYTYLQNNLDSLHDMREIMEIKGYTAPYRSINKY---GRPL 73  Methanobacteri...
WP_012955762    1 MDesLMITESEKFLNQIEREKLDLTNLksdfSDLESYLEVYELLKSNFDKLQDMKESMDERGYTAPFRSLNRY---GSRV 77  Methanobreviba...
WP_016358238    1 MDsnRLITKAEEYLKKISEEQIETSRL----SDFEYFKKTYDNLNNHLNILQEFKETMDTQGYTSPYRSLSKY---GIST 73  Methanobreviba...
jgi:Mfer_0607   1 MNeeGLISRTERLLSEIKKSSIKVDDL----RSYDKAFKIYRKLKSTLNKLEKIKKTMELKGYRSPYRSIAKY----STY 72  Methanothermus...
O26688          1 MNesGLIARSERFLESIKDRKVSLDDL----KSVEGFIDLYTYLRGNLEELQDLKEAMELRGFKYPFRSISGY---SSQY 73  Methanothermob...
Q6LYP0          1 MDssVLIKECNDFLDCLSNFGKKLKDFd--sKKEDSVNAVSETLENNLKILENFREKMELQGFDTPYIGVGRLk-gGED- 76  Methanococcus ...
Q2NI37         76 NPEIIPDDVHDQSRHAQYFRIKASNKKNILDQVKSAIASHKIAIGHLEEYVELECKKCGQKYKKKTLEDilvydenevES 155 Methanosphaera...
CDG65178       74 TGETKAEDMYDISRHTQYFRMNAAAKKNILDRVKSAISSHKIAVGHLEEFATLECSSCHKKYRGHEIALl--------TP 145 Methanobacteri...
WP_012955762   78 SEDVDYEELGELNRHNTIFRNNASAKKNSFDRVKYAIAAHRIALGNLEEYAKIRCKDCQKSYKVSTFLE---------NS 148 Methanobreviba...
WP_016358238   74 VADVTAEEASETHRHNQYFRLKASAKKNILDRVKSAIDAHKIALGNLEEYGLIHCKNCNKTYRIDNYK------------ 141 Methanobreviba...
jgi:Mfer_0607  73 IEEPIHEEPHEMARHARYFRIKASIRKNILDRVNSAIASHKIAISNLEEYIELKCVRCGKRFKIYE-------------- 138 Methanothermus...
O26688         74 SPEI-AEDVHDIKRHAQYFRMKASTKKNLLDRVNSAISSHRIALGNLEEYALLQCPDCSRSLRLSEVEYqd-----ilDG 147 Methanothermob...
Q6LYP0         77 ------DDIYEIINYSSYLRRMVDEKKGALERVKYAIVSHKIAIGNIQE------------------------------- 119 Methanococcus ...
Q2NI37        156 CKCECGS-SEFKFDSDMSGICRLELIKYLPLGGEYLLKRSQLTNYSLEAYRKIIKIMKQEKRGRVKSITVIAKIKDEntG 234 Methanosphaera...
CDG65178      146 GKCECGQ-NDLKLHVNQEGVYRLGIIPFLPLSGDYMVKLSELSPRSREAFRRIVRILKQEKRGIVKTVSLIIKVMED--N 222 Methanobacteri...
WP_012955762  149 KTCKCGS-TDFELKVNHSGIHRLEIIPYLPLSGNYMVLLSSLSGWGRDSFRRILNILQQKRKGVVKTVTPIIRIKEN--G 225 Methanobreviba...
WP_016358238  142 AECDCGK-TEYSFSINKNGNHRVDIIPYLPLAGDYMVKMSELTKWGRESFKKVINMLKQERKGSVKTVSLIIRYRED--K 218 Methanobreviba...
jgi:Mfer_0607 139 -KCECNReDEYKVVPNEKGIHRIEIIPYLPLSGDYMVKISKLSNWAREAFKKIVRTLRHEKRGTIKSTSLVIRVFDG--K 215 Methanothermus...
O26688        148 VMCPCGS-GRMEIEFSGSAICRPEIIPHLPLSGDYMVKMSELSLWARKAFKKIMRLFKNEKKGAVRSATLVIKVLED--G 224 Methanothermob...
Q6LYP0        120 ---DMGN---------------KKILAHLSYDGSYKELLSKIPPFFIKSYKRILSVFETEGKGILSSITLSLVILEN--G 179 Methanococcus ...
Q2NI37        235 KWVSRKMNIDYADESNYELELRKRYGPNVRIELLQFHHKKPSLINDKYVQNALAIAYLHYSENIVSKKIDEIIPKHIHNM 314 Methanosphaera...
CDG65178      223 RWVRKRVTIDAQDDANYEKEIRSQYGPNARIEMMQFHRKKPSIINDKHMQTALSLGYVKYAENRILQFLPDLLEKTLHNK 302 Methanobacteri...
WP_012955762  226 RTITKRVNLDSEFADCYEEELRRIYGKGVRIERLEFHSTKPTIVNDKYTRTNLALAYVKHAEDIVSRHEEEIFEENIKDL 305 Methanobreviba...
WP_016358238  219 KLIRKRVSLGSDYVNSYEEEIRKRYGKNVRIEALQFHRTKPAIIDDKNTRTALAIGYVKLAELIANRHKDEILKENIKDI 298 Methanobreviba...
jgi:Mfer_0607 216 RWLRKKIVINGSFE-ECENKLRKKYGSNLRIEFMQFHRRKARIIDDRYIRNALALGYTCFCENKIEKLKNEIFNSEMKNP 294 Methanothermus...
O26688        225 RWIRRRITIDSDDN-DYERMLRQRYGPNVRIELIQFHRKKSSIINDRYTRTALALGYAGLSHDIIMDIKERVYSEKLRDY 303 Methanothermob...
Q6LYP0        180 KRKFKRIKIEEE---DYEGYIKKTFG-DAIITSIKKNYSKNKLLNDQYVKKILSLAYLSACSDEIIEKIDETLKETLSDE 255 Methanococcus ...
Q2NI37        315 KK--IDTYNSVLNEARKDAGRLaREAE--ERIE--LEEELTYVKLRKVNLITKDHKLDRELKEDLNKESEIKKHYYIETP 388 Methanosphaera...
CDG65178      303 DK--VEEYQEAVEISKIKANKY-DTGD--DPES--LKNFYLKMELKDRGLLDKDGKPEKTLQNDLKEKNLLEKSLFHEMP 375 Methanobacteri...
WP_012955762  306 NN--LKTYDELIYSVNLEKPEYmDEDD---LDS--WREQKIQDNLLELGLMDKYGHLDKQLKKDLKERERIKSKIFADIA 378 Methanobreviba...
WP_016358238  299 DK--LNKYDEIVINAKTANPGFlDETD--SIEA--WREEKIDADLKDANLKYGNGDLNRTLEIDLRNRQLLEKSVFINIA 372 Methanobreviba...
jgi:Mfer_0607 295 EY--FEEYLRIIKDVERSl----LSLDpeIREE--IKEEEIKKVLKEKGFLNENEELIKEIREDLKIKKEIE-EVFVNVP 365 Methanothermus...
O26688        304 DA--VKRYRRILFEARTYSPDLrLSED--ELQE--VRVQKMHDLLHEAGLGDSGGRLNRELREDLEVMEEVKRELFRDVP 377 Methanothermob...
Q6LYP0        256 ERciVKKYRMICSDFKSSDCEs-GVIDvrAMEEikLRKMNLKNDLEDRGLY-KNGKPLKKLKESLEMEDEILENISLEVP 333 Methanococcus ...
Q2NI37        389 FILILWDIFKYYLTTSENRRNNYSGPFPNLRPTLDSNQIK--VFENiFPKDVIE---LLQDS-GENIDTIPNMKET---- 458 Methanosphaera...
CDG65178      376 RIYILWDILRYYLTTSYDRRNKYSGPFPYLRPGLDTNQIK--AFQD-FEVEVVK---IMQEYlSEDITYIPHMGRV---- 445 Methanobacteri...
WP_012955762  379 PTLILWDISKYYLCTSYDRRKRYGSPFPFIRNDLDRQQRK--VFAN-PHANVVG---LLREKeKKHMIAIDEMDLL---- 448 Methanobreviba...
WP_016358238  373 PSLILWDIFKYYLTSSNDKRKRQSGPFPYIRSEIDRQQRK--IFQI-TFTKAIE---LLNKKeHENILPVKEMDLI---- 442 Methanobreviba...
jgi:Mfer_0607 366 ITLLLWDIANYYLCTSYDRRTKHSGPFPGLRPVLDRHQAK--IFNE-FNKKAVK---IIKKYfMEKIEYIPNLNEI---- 435 Methanothermus...
O26688        378 VNLVLWDVALYYLGTSLDRRSKHAGPFPNLRPVLDRSQVR--TFDE-LSRDAVD---LLNTCwEGGMVYIDKLGDV---- 447 Methanothermob...
Q6LYP0        334 LKILSKDLLTYYLKKSADERTR-SNQFPSILVTPSPAHLNwlAVENiAPKKILDlkfLLEKElPKYEIPIKNLGGVslyl 412 Methanococcus ...
Q2NI37        459 -----IQYKLDLETKRKKLHLKSNhAAYGAIALNSKSNISLNKAADLLYV--DKDEAAKEKAALQKIEKPS---TNKAKK 528 Methanosphaera...
CDG65178      446 -----LSKKFSVEKKMKGLHLQMG-PALGAALLSSEANIPVEKSAQLFSI--KVEDVSKGKETLSTLQRPT---SSRAKQ 514 Methanobacteri...
WP_012955762  449 -----LYKKFKLEKRIKNTNFKLNyAALGPAIVFANSDYNIKEVSRAYKV--GEKSVKREIMNIKSFRKPN---SKKSRE 518 Methanobreviba...
WP_016358238  443 -----LHKKFKLEEELKNSNLKVNyQALGAAMIYNEGTIPIEECAKSFNL--DVKDVKKESKNIENIAKPK---NDKSKK 512 Methanobreviba...
jgi:Mfer_0607 436 -----ILENFKIERKMKGLRLKTDpFAFGAAIVNLKSDIDIEKCSKLFST--TPKNIKREKRNIKIITKPS---SDKAKR 505 Methanothermus...
O26688        448 -----LLKKFEIEDKMKGLHMKPNpLAFGAAVLHMEGEADIETCAEIFHV--RVEEVVEEKRNIENLGKPS---TDRAKM 517 Methanothermob...
Q6LYP0        413 lydwnVVESFEFEK------------------------TEIEEILKLMAAinDVKELLKDKIDIKKFEKYSkikKDKTKN 468 Methanococcus ...
Q2NI37        529 FLEIIN 534 Methanosphaera stadtmanae DSM 3091
CDG65178      515 FMAMMK 520 Methanobacterium sp. MB1
WP_012955762  519 FLGKIK 524 Methanobrevibacter ruminantium
WP_016358238  513 FLELIK 518 Methanobrevibacter sp. AbM4
jgi:Mfer_0607 506 FLEIVR 511 Methanothermus fervidus DSM 2088
O26688        518 FLNLIK 523 Methanothermobacter thermautotrophicus str. Delta H
Q6LYP0        469 FLNALg 474 Methanococcus maripaludis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap