3LKV


Conserved Protein Domain Family
ABC_sub_bind

?
pfam04392: ABC_sub_bind 
Click on image for an interactive view with Cn3D
ABC transporter substrate binding protein
This family contains many hypothetical proteins and some ABC transporter substrate binding proteins.
Statistics
?
PSSM-Id: 398203
Aligned: 6 rows
Threshold Bit Score: 329.021
Threshold Setting Gi: 6647972
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3LKV_A  10 KVAVSQIVEHPALDATRQGLLDGLKAKGYEEGKNLEFDYKTAQGNPAIAVQIARQFVGENPDVLVGIATPTAQALVSATK 89  Vibrio cholerae O1 bi...
Q9HXG8  32 SVAVTAIVEHPALDAARDGVKEALQEAGYEDGKNLKWQYQSAQGNTGTAAQIARKFIGDKPDVIVGIATPSAQALVAATK 111 Pseudomonas aeruginosa
Q9ZDG2  29 KVAVIVPLEHDSMYKIVSGIQEALKDIDVEI----LV--KNAHADPNILLAIINQIKDHDIDLIIPIGTTVSQTTISHII 102 Rickettsia prowazekii...
O67196  21 EINIAVFISGDGRLEKVGGFIKGLKDLGIKNIKIDLYKGNNSLKSLEDLAQNLN-LKTKRYRLIAAGGSLEAYILKKHGV 99  Aquifex aeolicus
Q99ZY6  40 TIGILQFVTHEALDDIKRGIEDQLKKQMPQK-QNVVIKVMNAEGDQSKIQTMSRQLVQSGSDIVIGIATPAAQGLAATSK 118 Streptococcus pyogene...
Q8DPW4  52 KIGVLQFVSHPSLDLIYKGIQDGLAEEGYKD-DQVKIDFMNSEGDQSKVATMSKQLVANGNDLVVGIATPAAQGLASATK 130 Streptococcus pneumon...
3LKV_A  90 T--IPIVFTAVTDPVGAKLVKQLEQPGKNVTGLS--DLSPVEQHVELIKEILPNVKSIGVVYNPGEANAVSLXELLKLSA 165 Vibrio cholerae O1 bi...
Q9HXG8 112 S--IPIVFSTVTDPVGAHLTPSWEASGTNVTGVS--DMLALDKQIELIKKVVPGAKRIGMVYNPGEANSVVVVKELKELL 187 Pseudomonas aeruginosa
Q9ZDG2 103 N--KPIVCAAA-------IINGKNLP--LVTGVN--DEIKITDTIS----KLPFLENITLIYSSSEK-VIPEVEMLKLYA 164 Rickettsia prowazekii...
O67196 100 NekIPVVILGGTSILSWGLTDSFSRPSENITGVNnlNAELMEKRIELFTYMFPDVRKVIIFCSPKFEASRKAARITIKTA 179 Aquifex aeolicus
Q99ZY6 119 D--IPVVMSAVSDPVGSRLVMQLDQPEANVTGLS--NKVPVKQTIDLMKKLTPHVKTVGILYASNEDNSLSQVKEFRRLA 194 Streptococcus pyogene...
Q8DPW4 131 D--LPVIMAAITDPIGANLVKDLKKPGGNVTGVS--DHNPAQQQVELIKALTPNVKTIGALYSSSEDNSKTQVEEFKAYA 206 Streptococcus pneumon...
3LKV_A 166 AKHGIKLVEATALKSADVQSATQAIAEKSDVIYALIDNTVASAIEG--XIVAANQAKTPVFGAATSYVERGAIASLGFDY 243 Vibrio cholerae O1 bi...
Q9HXG8 188 PKMGLSLVEASAPRSVDVSSAARSLVGKVDAIYTNTDNNVVSAYEA--LVKVGNDAKIPLIASDTDSVKRGAIAALGINY 265 Pseudomonas aeruginosa
Q9ZDG2 165 KNNNISLYTAMIQNLNDMPIAVKNAPKNTQSFIILKDHLIVSGINI--LKQEAFVRRIPLIASDEGSVINGATIAVGVQE 242 Rickettsia prowazekii...
O67196 180 KKFNLKVVPLYVKDVKELEFVMSHMKEDGYGAVIMTPCYYTENFLThyILHYANFYKVPVFCHSPEFAKEGCPVAYGTPA 259 Aquifex aeolicus
Q99ZY6 195 RKKGYQVISYAVPSTNEVPATMSVMLGKVDAVFIPQDNTIASAFSS--VMTTSKAAKIPVYTSVDRMVEKGGLAAISQNQ 272 Streptococcus pyogene...
Q8DPW4 207 EKAGLTVETFAVPSTNEIASTVTVMTSKVDAIWVPIDNTIASGFPT--VVSSNQSSKKPIYPSATAMVEVGGLASVVIDQ 284 Streptococcus pneumon...
3LKV_A 244 YQIGVQTADYVAAILEGKEPGSLDVQVAKGSDLVINKTAAEQLGITIPEAVLARATSTK 302 Vibrio cholerae O1 biovar El Tor str. N16961
Q9HXG8 266 KEMGKQTGRMVVRILKGEKPGEIKPETSDNLQLFVNPGAAQKQGVTLSDELLKSAAEVI 324 Pseudomonas aeruginosa
Q9ZDG2 243 KQIGVEAGLMAKKILQGIAPKDIPFSDMKDFTLFINLKSFLKQDILTQENLSVLPFKHK 301 Rickettsia prowazekii str. Madrid E
O67196 260 FEQGYTAAHVAYKILKGIPVENVPFVRAYSPKFILNLSALKELYVQYNERILVYADEVV 318 Aquifex aeolicus
Q99ZY6 273 YDLGVQTANQVLKLIKGKRVVDVPVKVVDIgQPLINKNVAAELGIAIKKEDFPSASFIE 331 Streptococcus pyogenes serotype M1
Q8DPW4 285 HDLGVATGKMIVQVLKGAKPADTPVNVFSIgKSVINKKIAQELGITIPESVLKEAGQVi 343 Streptococcus pneumoniae R6
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap