Conserved Protein Domain Family
DUF533

?
pfam04391: DUF533 
Protein of unknown function (DUF533)
Some family members may be secreted or integral membrane proteins.
Statistics
?
PSSM-Id: 398202
Aligned: 64 rows
Threshold Bit Score: 111.916
Threshold Setting Gi: 122378205
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_007636871    24 SSGGSLSRVV---TNTIIGTATgkigpKPSKNPLQTGa---LAAVGGM-----------AWNAYQaysrqaygrntslqn 86  Paraglaciecol...
ACR01176        89 ggrstSGGGLgdlLGGLLGGSA-----GGGTGTRSGGgnagMAILATI-----------AMAALKnwt------------ 140 Thauera sp. MZ1T
Q3JE61          49 GMTGGQVGGLgalAGALLGGGG-----SAAKGALGGSa---MAILGTL-----------AVSALQ--------------- 94  Nitrosococcus...
Q82V70          80 KLTGSQLTGIgalAGALLSGGV-----KASKGALGGSa---MAILGSL-----------ALNALKgh------------- 127 Nitrosomonas ...
jgi:Ocepr_1543  73 sgGRANTGGLealAGQLLGGGR-----PARARDLGGGl---MALLGGL-----------AMAAMAp-------------- 119 Oceanithermus...
Q2LYB4          87 snKNIAIGGLgalIGSLLGGGG-----KSLGGAVGGGl---MALLGTL-----------AFNALKg-------------- 133 Syntrophus ac...
ESQ10795        72 annKMAVGGLgalAGALLGGGGg----GAARGAVGGGg---LAMLASL-----------AFSALQq-------------- 119 uncultured De...
Q28RE5          90 MLGGGAAGGM---LGGLLGGGG-------------GGg---TSAFGRR-----------LNQSLM--------------- 124 Jannaschia sp...
Q164B4          26 gaSGSAAGGLgdiLGQLTGGGG-------ASAAGAAGg---LGGLGGLlgslagarggdAAGGFEnlin----------- 84  Roseobacter d...
WP_020951904   166 ILAGAVSGGLgglLGGLLSGRGpt-asPMDGLAHKDSqphnEASFGEV-----------LNDAIA--------------- 218 Paracoccus am...
WP_007636871    87 anlqrayqlgvyaqrNAQQQkyapnqsqgmpeqaasssttafatEAAPQSryipsapkqtltyspatltqqqfaqvvrde 166 Paraglaciecol...
ACR01176       141 ------------------------------------------dgRRAQAAmapdtagf--------------aapeletm 164 Thauera sp. MZ1T
Q3JE61          95 --------------------------------------------DKQNTPtssgnltsgaq---------plpqeqieal 121 Nitrosococcus...
Q82V70         128 -------------------------------------------lAAGNTSasaadid----------------ryameai 148 Nitrosomonas ...
jgi:Ocepr_1543 120 --------------------------------------------DGRRPArapvglra--------------petseeee 141 Oceanithermus...
Q2LYB4         134 --------------------------------------------SGQSKPqlpvglle--------------pqtdeeqq 155 Syntrophus ac...
ESQ10795       120 --------------------------------------------AGQQPAdtprglle--------------pqneqesq 141 uncultured De...
Q28RE5         125 ---------------SGGEP------------------------EDEPTE------------------------------ 135 Jannaschia sp...
Q164B4          85 ------------qdnPATEP------------------------------------------------------------ 92  Roseobacter d...
WP_020951904   219 ---------------TGNEP------------------------QIPPTP------------------------------ 229 Paracoccus am...
WP_007636871   167 SHDSGQMLMLRAMITAANADGHIDEHERQRIYQQVDSFDLTTEDKASLFDELRHPLSLQELVKAV-PNSQTAIEVYAASL 245 Paraglaciecol...
ACR01176       165 TEPATAELIVRAMISAAKADGEVSEDEIQRIVGRIGADGLSEEEKQFMIAELRRPLDLAALVAEV-PNEMVAVEVYAASL 243 Thauera sp. MZ1T
Q3JE61         122 AAPQTEQLMVRAMITAAKADGQLDQKEMDNIFGKISADGVTDEERQLVMDELSRPMDLQALVSAV-PNKAVAAEVYAASL 200 Nitrosococcus...
Q82V70         149 DDPDTQRLIVRAMIAAAKADGIIDEQENARILGKVGEDGVTEAERQLVDEELRRPADMAALVAEV-PNQVVAAEVYSASL 227 Nitrosomonas ...
jgi:Ocepr_1543 142 ELENAAQVVLMAMINAAKADGRIDPDEARRIVGRLDAMNADREVRDWVFEQMSGPPDAGPVVEAArGDPELAAQVYAATL 221 Oceanithermus...
Q2LYB4         156 ALEQTSELVLRAMINATKADGEIDQDEINRIVGKFEEIGVDEEGRRYVMNQLRQPMETEELIAAAkGQPELAVQIYAASL 235 Syntrophus ac...
ESQ10795       142 ALENDAELIVKAMINAAKADGNIDEGEIERIIGKMQEDGLTEEEKQFFQTEAAKPIDIESIAAPArGDAELAAQVYAASL 221 uncultured De...
Q28RE5         136 DEEAMAALMIRAMIMAAKSDGRIDRDERAMLTDRLGDLS--ARERQFVEDELNARIDVRDFARDVpDHPGLRAQIFAAAM 213 Jannaschia sp...
Q164B4          93 DEEEVARLMLRAMTQAARADGDIDAEEKAKLLDALQDGD--PSDMEVVQKILAEPVSAQALAADT--PRGLETQVYTMSL 168 Roseobacter d...
WP_020951904   230 EQNAVAGLLLRAMIQAAKSDGQIDDREMQRLVAETGEQD--GPERDFIREQMAAPVDPIALARET--PQGLGPQVYLVSL 305 Paracoccus am...
WP_007636871   246 LAIDEQQAASQDYLSNLASYMLIPPELVKALHAQA 280 Paraglaciecola psychrophila
ACR01176       244 LAIELDTPAEAAYLRQLAQALRLDGATLSRLHEit 278 Thauera sp. MZ1T
Q3JE61         201 FAIDIDTEAERAYLQQLAQALGLDRATVSRLHELt 235 Nitrosococcus oceani ATCC 19707
Q82V70         228 LAINVDTEKEENYLRELAKLLGLDAAAVARLHQLT 262 Nitrosomonas europaea
jgi:Ocepr_1543 222 LAVEVDTAAENRYLEELQRALDLPAAVAARIERAV 256 Oceanithermus profundus DSM 14977
Q2LYB4         236 LAVEVDTQAEKDYLDQLAAGLGLTPQLTERIQQMI 270 Syntrophus aciditrophicus SB
ESQ10795       222 LAIEVDTDAERHYLQQLSTALNLSPQVTAIIHQSL 256 uncultured Desulfofustis sp. PB-SRB1
Q28RE5         214 SAIDIDSPREREFAEDLANALGLEEKARGHVQQRM 248 Jannaschia sp. CCS1
Q164B4         169 NAISPDNQAEGQYLHALAQGLSMKPDTVNQIHDSL 203 Roseobacter denitrificans OCh 114
WP_020951904   306 MAIDFDNEAEARYLHALAEALGLAQEQVNAIHQQV 340 Paracoccus aminophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap