Conserved Protein Domain Family
DUF496

?
pfam04363: DUF496 
Protein of unknown function (DUF496)
Statistics
?
PSSM-Id: 398181
Aligned: 13 rows
Threshold Bit Score: 120.921
Threshold Setting Gi: 469488970
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6LQR1              1 MNNILELVRQTRRKNKLKREILDNDRKIRDNRKRVELLENLLDYIRPDMSQEAILEIVENMKGDYEDRVDDHIIVSAELS 80  Photobacte...
A1SY66              1 MDNLLELVRNTRRKNKLKREILDNEKKVRDNTKRVDLLSNLLEYIKPNMSPEDIKCIIENMRDDYEDRVDEHIIKGAELS 80  Psychromon...
UNSW:PCNPT3_08120   1 MGNVLDLVKNTRRKNKLQREMVANEKKIRDNRKRVELLNNLVEYITPAMSQEEITLIIKNMLSDYADRVDDHIIIGAELS 80  Psychromon...
Q5DZX0              1 MNNVFEIINQARRKNKLKRELQDNQKKIRDNQKRVTLLENMLDYIHPTMTTAEVIAVVENMKADYEDRVDDHIIKSAEIS 80  Aliivibrio...
Q9KLK2              1 MNSVFEIVSLARRKNKLQRELDDNEKKVRDNRKRVELLVNLLDYIKPNMSHEEILGIIKNMKSDYEDRVDDHIIKSAEIS 80  Vibrio cho...
Q8RG97              1 MDSVLELVRKERRKNQIKREIEDNDRKIRDNRKRVELLLNLKEYLKVNMSYEEIIDIIENMQSDYEDRVDDYIIKNAELG 80  Fusobacter...
jgi:Tola_0263       6 MNNILEFVRVARLKNKLTREIEDNARKIRDNQKRVALLANLTEYLKPGMSYEDILEIIHNMKGDYEDRVDDLTIVGAELS 85  Tolumonas ...
P57621              8 FKNVLEFVHKFRRKNKIKREISDIEKKIRDNQKRILLLDNLIQYITLDMNYEEIKKIIFMMKSDYEDRIDDYIVKNAELS 87  Buchnera a...
Q7VQX3             10 FYSVLEFVRIFRRRNKLQREISDNEKKIRDNQKRVLLLRNLIDYIKSENSIEGVQVIITNMCNDYEDRVDDYIIKNAELS 89  Candidatus...
Q8ZFW5              9 FQDVLEFVRMFRRKNKLQREIVDNEKKIRDNQKRVLLLDNLSEYIKPGMSIEEVQAIIANMRGDYEDRVDDYIIKNADLS 88  Yersinia p...
A6VMU2              9 FQEVLEYVRINRQRNKLLREIGDCERKIRDNKKRVLLLDNLTDYIQDNMTIEDIRAIINNMHDDYENRVDDYVIKAAELS 88  Actinobaci...
Q65S81              9 FQDVLEYVRLYRLRNKLLRDIGDNDRKIRDNQKRVLLLDNLSQYITNDMSVEDIRAIIENMRDDYEGRVDDYMIRNADLS 88  [Mannheimi...
USMARC:WQG_10660    1 M---LDYIHLYRLKNKLLRETADNDKKIRDNQKRILLLDNLNQYISNDMTVEQIRTIIMDMRDDYENRVDDYIIRNAELS 77  Biberstein...
Q6LQR1             81 KERREVSKNVKDL 93  Photobacterium profundum SS9
A1SY66             81 KERREMNKKISSF 93  Psychromonas ingrahamii 37
UNSW:PCNPT3_08120  81 KERRDLNNKINNF 93  Psychromonas sp. CNPT3
Q5DZX0             81 KSRRDISRKIREL 93  Aliivibrio fischeri ES114
Q9KLK2             81 KERRDISRRIKDL 93  Vibrio cholerae O1 biovar El Tor str. N16961
Q8RG97             81 KERREISKTIKDF 93  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
jgi:Tola_0263      86 KQRREASKQLRNF 98  Tolumonas auensis DSM 9187
P57621             88 KEKRNLSKELKFI 100 Buchnera aphidicola str. APS (Acyrthosiphon pisum)
Q7VQX3             90 KERRELSKKLKQF 102 Candidatus Blochmannia floridanus
Q8ZFW5             89 KERRELSKKLKAM 101 Yersinia pestis
A6VMU2             89 KQRRDLKTRMKEL 101 Actinobacillus succinogenes 130Z
Q65S81             89 KERREIKEKMKAQ 101 [Mannheimia] succiniciproducens MBEL55E
USMARC:WQG_10660   78 KERREIRKKMADC 90  Bibersteinia trehalosi USDA-ARS-USMARC-192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap