2MZY,1XS8


Conserved Protein Domain Family
Iron_traffic

?
pfam04362: Iron_traffic 
Bacterial Fe(2+) trafficking
This is a family of bacterial Fe(2+) trafficking proteins.
Statistics
?
PSSM-Id: 398180
Aligned: 93 rows
Threshold Bit Score: 122.25
Threshold Setting Gi: 301796099
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2MZY_A        3 RMIHCAKLGKEAEGLDFPPLPGELGKRLYESVSKQAWQDWLKQQTMLINENRLNMADPRARQYLMKQTEKYFFGEG-ADQ 81 
Q21NX9        3 RTVNCRKFKQELEGLDFPPMPGAKGQDIFENVSKKAWQEWLSHQTMLINEKHLNMMDLTDRTYLNQQMDKFLSGEE-YDQ 81  Saccharophagus d...
Q2SMB8        3 RMVFCKKYQQELEGLALPPMPGARGKELFETVSKKAWQEWLQHQTMLINEKRLNLMDPDARTYLTEQMEKFLNNEN-FDA 81  Hahella chejuens...
C5BM93        3 RTVHCRKYNKEMEGLAVPPLPGAKGTELFNSVSKQAWQEWLQHQTMLINEKQLNLMDLTARAYLTEQMEKFLSGAD-YDQ 81  Teredinibacter t...
WP_015047980  3 RTVFCRKYQQELEGLAVPPFPGAKGQDLFEHVSKKAWSEWLAHQTMLINEKHLNLMDLTARAYLQEQMDKFLSGQD-FDQ 81  Simiduia agarivo...
B3PJ20        3 RMVFCRKYKQQLEGLDFPPYPGAKGQDLFDNVSKKAWQEWMAHQTMLINEKRLNVMDMGTKVYLTEQMHKFLSGEG-YDQ 81  Cellvibrio japon...
CBL44304      3 RQVFCRKYKQDLEGLPRPPYPGPRGQMIFEQVSKQAWNEWLKHQTRLINEKRLNLMQAETQAYLAGELEKFLDGAN-FDQ 81  gamma proteobact...
Q4FVJ7       10 NTVFCRKYQQDLPKMPHPPFPNKKGQELQETVSEKAWKEWLEQQTMLINENHLSMLDPKAKQFLTEQRDKFLDNED-YER 88  Psychrobacter ar...
WP_003662180  9 HMVFCRKYQQNLPKLPNPPFPNAKGQEIQDTISAKAWNAWLELQTMLINEKHLSMIDPQAKKYLNEQREKFLDNGD-YEK 87  Moraxella
Q6FFB3        3 RLVFCRKYQQEMEGLDFAPFPGAKGQEFFDNVSKQAWQEWLQHQTTLINEKRLNVFEPEAKKFLEEQREKFFNNDAsVEK 82  Acinetobacter ba...
2MZY_A       82 ASGYVPP 88 
Q21NX9       82 AEGYVAp 88  Saccharophagus degradans 2-40
Q2SMB8       82 AEGFVPK 88  Hahella chejuensis KCTC 2396
C5BM93       82 ADGYVPK 88  Teredinibacter turnerae T7901
WP_015047980 82 AEGYVPP 88  Simiduia agarivorans
B3PJ20       82 ADGYVPP 88  Cellvibrio japonicus Ueda107
CBL44304     82 AEGFVPP 88  gamma proteobacterium HdN1
Q4FVJ7       89 AQGWTPE 95  Psychrobacter arcticus 273-4
WP_003662180 88 PAGYKPl 94  Moraxella
Q6FFB3       83 AEGWKPe 89  Acinetobacter baylyi ADP1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap