Conserved Protein Domain Family
ZipA_C

?
pfam04354: ZipA_C 
ZipA, C-terminal FtsZ-binding domain
This family represents the ZipA C-terminal domain. ZipA is involved in septum formation in bacterial cell division. Its C-terminal domain binds FtsZ, a major component of the bacterial septal ring. The structure of this domain is an alpha-beta fold with three alpha helices and a beta sheet of six antiparallel beta strands. The major loops protruding from the beta sheet surface are thought to form a binding site for FtsZ.
Statistics
?
PSSM-Id: 398172
Aligned: 97 rows
Threshold Bit Score: 101.415
Threshold Setting Gi: 75356379
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015832027  353 TMGFHLVHGDHGAFTGTKLRGLSEAQGMVLEADGAFKYYDESDpsisqAPSVSFAMFNRDNYPFSPEMLRTSVVKAVTFQ 432 Methylotenera ...
Q7NR80        253 LIGINIVPR--SAIEGARLRSFAEAAGLQLEPDGAFHYLADSG-------NTLYSLVAADQMPFTFHTLLDKSFPALTLL 323 Chromobacteriu...
hku:LHK_02879 307 lvgINLVAG--QPFFGTKLRSLAEANGMKLEADGQFHAYSDSG-------SHLYTLMSSDSRPFVSQELLEKRFSQVTLL 377 Laribacter hon...
Q5F9Z8        282 TIAIHLVSPTS--ISGVELRSAVTGVGFVLEDDGAFHY--TDT-----SGSTMFSICSLNNEPFTNALLDNQSYKGFSML 352 Neisseria gono...
jgi:Galf_1198 219 MVGINLLPPGERLLNGEKIADAVALHGMTLESDGAFHLSNSSG-------NSQLTLINKDTKPFQHHSLAQFTTGGITLM 291 Gallionella ca...
jgi:Slit_1291 203 MIGINLLTSGDRKLFGTEVSNAAGRLGMDLQSDGAFHLLDESG-------ETLFSLGSSDGSPFQHHTLNQSRVDSLTLL 275 Sideroxydans l...
Q5NYU2        222 qIGVNIISH-NQPFAGTKIRALAEASGMTIGDDGAFHARDESG-------HTLFTLCNMEPALFAADEMRNLMTNGLTFV 293 Aromatoleum ar...
WP_011765733  226 QIGINVVAT-QQPFLGTKLRGLAEAEGLALADDGSFHMRDEAG-------NTVFTLSNLEPTLFTAENLRTVQTHGITLV 297 Azoarcus sp. BH72
WP_004301383  214 QIGINVVSR-EGQFEGRAIHAVAEKHGLRLGADGAYHMVDGE--------HSVFTVANLESGRFSPESLKGLVTRGLTLV 284 Thauera
BAL25107      216 qIGINIVSS-GQPFAGTKIRALAESNGLVIGNDGAFHACDEDG-------NTLFTLSNMEANIFAADTMRNIATHGMTLL 287 Azoarcus sp. K...
WP_015832027  433 LDIPHVVHCTEAFNHM-VQIARHMETGLNAVLVDDNNRPLGDMQIEKIRQQ 482 Methylotenera mobilis
Q7NR80        324 FDVPRVAGGVDVFDRA-VHFARQLAQEFDAQLVDDNRRVLSETGLARIRDQ 373 Chromobacterium violaceum
hku:LHK_02879 378 FDVPRVAGCATVFDRA-VLFAQQLARSLKADLVDDAGRPLTEAGLQTIRQQ 427 Laribacter hongkongensis HLHK9
Q5F9Z8        353 LDIPHSPAGEKTFDDLfMDLAVRLSGQLNLNLVNDKMEEVSTQWLKDVRTY 403 Neisseria gonorrhoeae FA 1090
jgi:Galf_1198 292 LDVPRVENPAASFDLM-VQIARDLARDLQVNLVDDHRVQLTDAGLAKIRAQ 341 Gallionella capsiferriformans ES-2
jgi:Slit_1291 276 LDIPRVDEPVRHFDQM-VVLAQELARTLRASMVDDQRVALSDGAIAQIRAQ 325 Sideroxydans lithotrophicus ES-1
Q5NYU2        294 IDVPRVANGVVVFDHM-MQQANHMADALQGNVVDDNRAPFGPDAALLIRSQ 343 Aromatoleum aromaticum EbN1
WP_011765733  298 IDVPRVANGAACFERM-MQLATHLAGALQGVVVDDNRAPFGVDAAGMIRSQ 347 Azoarcus sp. BH72
WP_004301383  285 IDVPRVSNGGAAFDRM-MKMATTLAGELGGDVVDDNRAPFGAEAATIIRNQ 334 Thauera
BAL25107      288 IDVPRVPNGVFAFERM-MRQASQMADALQGVVVDDNRSPLGPEAANMIRNQ 337 Azoarcus sp. KH32C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap