2P7V


Conserved Protein Domain Family
Rsd_AlgQ

?
pfam04353: Rsd_AlgQ 
Regulator of RNA polymerase sigma(70) subunit, Rsd/AlgQ
This family includes bacterial transcriptional regulators that are thought to act through an interaction with the conserved region 4 of the sigma(70) subunit of RNA polymerase. The Pseudomonas aeruginosa homolog, AlgQ, positively regulates virulence gene expression and is associated with the mucoid phenotype observed in Pseudomonas aeruginosa isolates from cystic fibrosis patients.
Statistics
?
PSSM-Id: 398171
Aligned: 52 rows
Threshold Bit Score: 157.742
Threshold Setting Gi: 306526526
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2P7V_A            1 MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKL 80 
WP_015006731      8 Q-------KKERTQTSGLIRELLEERKQVWSSYCAVSGI--EEHKGQKPIEELLQDFCQLTVDYISLGHFGVYQRILAGN 78  Cycloclasticus
WP_013024121      1 MLNQLDVLTKRVGGSNELVDSWLAARRQLLVSYYHLVGIKPKKEALTRLDEQALDNFCHNLVDYLSSGHFSLYQRLIGEM 80  Pantoea
WP_013200306      1 MLNQLEVLTARVGGCSDLVDFCLRSRRQLLIAYYRLVGIKPNKESLTTLDENALDSFCQGLVDYLSTGHFTVYQRFIQEM 80  Erwinia bill...
IEC:ABF-0014923   1 MLKQLQRLTENVGGNYALIDQWLLARKHLLLAYYHLLSIQT----GKIPEARTLDEFCHHLVDYLSVGHFHVYERMLQEN 76  Dickeya dada...
Q6DAL9            1 MLNQLQSLTEYVGGNNALIDQWLQARKQLLVAYYHLVGIKPNKEALSLLDEEALDNFCQNLVDYLSTGHFHLYEKMLHEA 80  Pectobacteri...
Q2NWR3            1 MLNQLENLAKCVGGNNELIDQWLQARKGLLVAYYHLIGLKPNKEKHTPLDEEALDAFCHQLVDYLSAGHFLVYDSIVPEG 80  Sodalis glos...
wugsc:KPN_04377   1 MLNQLENLTERVGGSNELVDRWLQVRKHLLVAYYNLVGLKPGKESFMRLNEKALDDFCQSLVDYLSSGHFSIYERIIGEM 80  Klebsiella p...
WP_002445258      1 MLNQLKSLTERLNGNNTLVDQWLLQRKHLLIAWYNLVGLTPGKSSLAAIDEMALDAFCQGLVDYLSAGHFHIYARIIGEI 80  Shimwellia b...
WP_015699031      1 MLNRLERLTQRVGGSNELVDQWLHARKELLVSYCTLVGLKPNKEKHTPLNEKALDNFCHNLVDYLSAGHFHLYQRLIDEV 80  Rahnella aqu...
2P7V_A           81 EGNGQ--LARAAKIWPQLEANTQQIMDYYDSSLEtAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLV 148
WP_015006731     79 ERRKSv-LAAAERIYPSISKATETVLDFNDKYQT-LTPAMILNELASDLSSVGENLANRIELEDQLIGEM 146 Cycloclasticus
WP_013024121     81 DGTSP--LLAATQIYPSLEANTEQLMKLYDGHLQqAIDDDNYVTFQNALSEVGEALEGRFTLEDKLIQMA 148 Pantoea
WP_013200306     81 EGSEQ--LAKAALIYPSLQANTEMIMQVYDTHLEkAIDHDNCLEFQNALSTVGEALEARFTLEDRFIQLA 148 Erwinia billingiae
IEC:ABF-0014923  77 IMRNDrkLTQASHFDVALRSNTQQIMDIYDSHLAfFIDPVDSQEFRQTLSGVGEALAMRFTLEDSLIRLM 146 Dickeya dadantii 3937
Q6DAL9           81 ATHSEqvLALSTQLDFALQNNTQQIMTFYDSHLAaAIDHDNCIEFQQALSSVGEALEERFTLEDNMIKQV 150 Pectobacterium atrosep...
Q2NWR3           81 ESSST-------LTYSGLQENTQQIMALYDSHLEnAIDHDNYLSFQEALSGVGEALATRFVLEDKLIQQA 143 Sodalis glossinidius s...
wugsc:KPN_04377  81 EGDTP--LLAATRLYPQLEANTQQMMDYYDTCLEnAIDHDNYLEFQQALSDIGESLEARFALEDKLIALA 148 Klebsiella pneumoniae ...
WP_002445258     81 KGNYA--QLATSQICPQLEANTQQIMAYYDLHLEsALEHDDFAEFQQALSGLGEAMETRFALEDKLMLma 148 Shimwellia blattae
WP_015699031     81 EGANSpiKLQAAKIYPALELNTEAIMAFHDSYTEnDIDDDNAFAFHYALSDIGEALDARFQLEDQLITLA 150 Rahnella aquatilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap