Conserved Protein Domain Family
DMT_6

?
pfam04342: DMT_6 
Putative member of DMT superfamily (DUF486)
This family contains several proteins of uncharacterized function. The family is represented in the Transport classification database as 2.A.7.34, though the exact nature of what is transported is not known.
Statistics
?
PSSM-Id: 398164
Aligned: 131 rows
Threshold Bit Score: 134.551
Threshold Setting Gi: 146232965
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
wustl:BD2064           6 TILLLIVSNIFMTCAWYGHLKMkQQfswfehlPLFGVILFSWFLAFFEYCFQVPANRIGFRDnggpFNLIQLKVIQEVIT 85  Parabac...
WP_012286210          10 pWCLLVASNVFMTFAWYGHLK--NRs-----mTLLLAIVSSWLIALPEYMLAVTANRLGHSV----YTTAQLKTGQEAIT 78  Cauloba...
jgi:AciPR4_2315        6 vpiLMLASSTLMATAWLGHLRFrNSi------GFWMALGASWLLVLPEYVLNVGATRFGYGT----YSGAQMASFHLAGG 75  Terrigl...
WP_014133055          16 PILLLIASNVFMTFAWYGHLKFpGA-------ALWVVVLVSWGIAFFEYWLAVPANRIGYGT----YSAAELKTIQEVIS 84  Pelagib...
CCH:MU9_1609           7 PIFLLVLSNIFMMFAWYGHLKFaGK-------PLIAVIFFSWLIALAEYCLAVPANRIGHQY----YSAAELKTMQEVIT 75  Morgane...
CAR43985              10 PIILLIISNIFMTFAWYGHLKYgNK-------PLIIVILLSWLIAFVEYCFAVPANRIGHNY----YSAAELKTIQEVIT 78  Proteus...
Q2W577                 8 PIGLLVISNVFMTFAWYGHLKFtDR-------AMWIAIVVSWLIAFVEYCFAVPANRIGHGT----YSTAELKTMQEVIT 76  Magneto...
zhongguo:SL003B_3575  12 TIGLLLASNIFMTFAWYGHLKFkSA-------SLWTVILASWGIAFLEYCFQVPANRIGHGY----FSAVELKTIQEVIT 80  Polymor...
jgi:Astex_1688        10 TVLLLIGSNIFMTFAWYGHLKIkHE-------KLWILILASWGIAFFEYCLMVPANRIGYGV----FSAAQLKTIQEVIT 78  Asticca...
rhodo:RCAP_rcc00905    9 TFLLLTASNVFMTFAWYGHLRFkSA-------PMLVAIGISWGIAFFEYCLMVPANRIGYGT----MSAAQLKVMQEVIS 77  Rhodoba...
wustl:BD2064          86 LVVFVAFSTIAFKgESFKWNHALAFVFLVAAVYLVF 121 Parabacteroides distasonis ATCC 8503
WP_012286210          79 LVVFSLFSVFYLG-EAIRWTTLLGFGFIFVGVAIVm 113 Caulobacter sp. K31
jgi:AciPR4_2315       76 VICVALISHYLLG-ERLGAIQLFGFVLLAVAMVLIM 110 Terriglobus saanensis SP1PR4
WP_014133055          85 LSVFALFAIFYLG-EKFTLNHVLGFAFIAVGAFFIF 119 Pelagibacterium
CCH:MU9_1609          76 LCVFMVFSVAYLG-ESITLNHLIGFGFIAAGAFFIF 110 Morganella morganii subsp. morganii KT
CAR43985              79 LTIFAVFSVTYLG-ESFTLNHFIGFILIGAGALFIF 113 Proteus mirabilis HI4320
Q2W577                77 LTVFAGFSVLYLG-ERLTINHAIGFALICAGAFFVF 111 Magnetospirillum magneticum AMB-1
zhongguo:SL003B_3575  81 LTVFAGFSVLYLG-EAIRINHVIGFALIAAGAFFVF 115 Polymorphum gilvum SL003B-26A1
jgi:Astex_1688        79 LSVFVLFSVFYLG-EAIRWTHIVGFALIALGAGFIF 113 Asticcacaulis excentricus CB 48
rhodo:RCAP_rcc00905   78 LTVFVGFNTWWLG-EPPTWRTLGGFALIIAGAALIF 112 Rhodobacter capsulatus SB 1003
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap