Conserved Protein Domain Family
DUF473

?
pfam04322: DUF473 
Protein of unknown function (DUF473)
Family of uncharacterized Archaeal proteins.
Statistics
?
PSSM-Id: 398151
Aligned: 30 rows
Threshold Bit Score: 114.199
Threshold Setting Gi: 74560010
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Metfor_1036   1 MKCAALTSISPDIIKELKSGRPRTIELQSTHNIVTVAE-VEPGpdTHIFMTSTDVEDLSPGDAGICVFVLSTSLSMKRVV 79  Methanoregul...
WP_013683930      1 MRCYVLTGISRKTLEDLVKRNIRAIELRSAHNVATALK-ADIG--SCVFLTPSKLYNVGRGTTGIIAEVSGKEVMSHSII 77  Archaeoglobu...
CGB:Asulf_01549   1 MRCFVFTGISRVIIEDVIKGMVKTIELRSAHNVATALK-ANVG--NCVFLTPTRLYDLSRGVSGLVAEVTGKEVISHSIF 77  Archaeoglobu...
jgi:Ferp_0983     1 MRCWILTGISRRVIDDIISGYTRTIELRSAHNVSIAMK-AEVG--DCVLLTPARFYELDRGIVGLIAEVVGKEVHSHSIV 77  Ferroglobus ...
WP_012939873      1 MKCLVLTGISKDVLDDLMRRHIKTIELRSAHNIATAMR-AEVG--DCVFLTSAKTFDVDRGTLGIIAQVTGKEIYSHSLM 77  Archaeoglobu...
Q8U4R0            3 vEIPLLSGIARRTLDALMRNPIRTVEIRNARNYMTLEK-VKEG--DLVFLTYESLEDVMRGTEGIIAMVTRMEKSHQRVP 79  Pyrococcus f...
Q5JEQ4            1 MEAVLIAGIARRLLDELLRNPYRTIELRSARNVLAVERaMEDL--RRLFLTYEPFEDVRTGTEGLITELIEARELNMRVP 78  Thermococcus...
Q57569           39 MKVYGLFGINENAINDFIENHIKTFTIINALNLETVKN-LKEG--DLVFITSTLREDLRNGTEGILGRVINVSLVPQMIn 115 Methanocaldo...
jgi:Mvol_0973     1 MKTLAITGISKGGLSELLKNQVRTFVLKNVANYSVLTN-SEIG--DVLFITSIHKSDLTVGTEGVIAKLISMDICNNINY 77  Methanococcu...
Q6LYS5            1 MKALALTGVGPYAISEIVKNHVKTLNLKNICNLLALES-LNVG--DFLFITNVSKEDVISGTEGLIVQVKNISINNQNGY 77  Methanococcu...
jgi:Metfor_1036  80 EFSQggtMYEERERVSARVQVKFCATSVIKGVYRDGLMKPTKV 122 Methanoregula formicica SMSP
WP_013683930     78 FASNh--YIEESEMTVVRLRLTPRSVGRIVTVYNADILDSTEa 118 Archaeoglobus veneficus
CGB:Asulf_01549  78 LSTDr--FMDESEMTVVKLRLKPKCIGRILNVLNAGILDSTea 118 Archaeoglobus sulfaticallidus PM70-1
jgi:Ferp_0983    78 FAKEg--FVEESEMTAVRLKLKPRGIGRVVAVKKKELLGEveg 118 Ferroglobus placidus DSM 10642
WP_012939873     78 FSTPt--LIQESEMTVVRLKLEVRGVGRVVRVYNTGILDTTEa 118 Archaeoglobus profundus
Q8U4R0           80 WEES-----DEREISICRVQLKLVGLGRVVEVQEKNGVVFVKV 117 Pyrococcus furiosus
Q5JEQ4           79 WEES-----DEREVTVCRARVKLLGLGRVVEMERRDSITVVKV 116 Thermococcus kodakarensis KOD1
Q57569          116 -------GFEEKEIIAGRVQLEMLGFAKCV--KYESIHVEITF 149 Methanocaldococcus jannaschii DSM 2661
jgi:Mvol_0973    78 EEKA-----DENETVVINAQFEFLGYAVCLDVAESEEYpiiqp 115 Methanococcus voltae A3
Q6LYS5           78 SRSC-----DEIESIVGKVQVELLGYASCSNVVETGLMDPSVV 115 Methanococcus maripaludis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap