3WTR


Conserved Protein Domain Family
EpmC

?
pfam04315: EpmC 
Elongation factor P hydroxylase
This family catalyzes the final step in the elongation factor P modification pathway. It hydroxylates Lys-34 of elongation factor P. Members of this family have a conserved HEXXH motif, suggesting they are putative peptidases of zincin fold.
Statistics
?
PSSM-Id: 398145
Aligned: 40 rows
Threshold Bit Score: 259.051
Threshold Setting Gi: 399160761
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3WTR_A           13 IFNSCFADE-FNTRLIKGDDEPIYLPA-------DAEVPYNRIVFAHGFYASAIHEISHWCIAGKARRELVDFGYWYCPD 84 
Q21LL0           39 VFHAVFFEP-FNTQLIAHGQEPLYSPA-------TPSQP-AKIIFSHDYFASALHEVAHWCVAGAERRKLEDYGYWYAPD 109 Saccharophag...
Q0VP97           33 LFRATFFHS-HDTLLVGGAAEPVYLPG-------SP----HRICYTHDYFRSALHEIAHWCVAGPVRRQQQDYGYWYAPD 100 Alcanivorax ...
tigr:TERTU_1125  16 LFNQCFLDSeYNTCLEGQGEEPIYLPR-------GGGRDVNTIVFTQDYFSSALHEVSHWCIAGPQRLAQVDYGYWYAPD 88  Teredinibact...
WP_010786371     14 IFDACFAES-YNTRLERGGDYPIYLPAfidegnvASERPYNVILFAHGYYSSALHEIAHWLVAGTERRKLEDFGYWYEPD 92  Glaesserella...
Q9CNG3           11 IFNQCFEQE-YNTILVKGGDEPLYVPA-------NENCPHHVIYFARGFYSSGLHEIAHWLVAGKARRQLEDFGYWYEPD 82  Pasteurella ...
P44255           11 IFNQCFEEE-YNTRLVKGGDEPIYLPA-------NDEVPYNAIYFARGFYSSALHEIAHWLVAGKERRKLEDFGYWYEPD 82  Haemophilus ...
Q5ZUA1           10 IFNSCFEKD-YNTRLVRGRDEPIYLPA-------DDKRPYHALFFAHGFFSSALHECAHWLIAGEERRKLVDFGYWYAPD 81  Legionella p...
CBJ11604         10 LFEICFAKE-YNTKLVKGNDEPIYLPA-------DAKRPFHAICFAHGFFSSALHECAHWLIAGEERRKLVDFGYWYMPD 81  Legionella l...
SDU:GNIT_2207    22 LFNACFANT-ENTQLVGNADEPIYQPS-------SGDGQCSLVIFTQDYFSSALHEIAHWCIAGKERRTLVDYGYWYLPD 93  Glaciecola n...
3WTR_A           85 GRDAQTQSQFEDVEVKPQALDWLFCVAAGYPFNVSCDNLEGdFEPDRVVFQRRVHAQVMDYLANGIPERPARFIKALQNY 164
Q21LL0          110 GRSEDQQKEFERVEVRPQALEWIFSVAAGQPFRVSADNLAQ-GLGPSGAFKQAICDQAQVFCREGLPSRPAMFVEALEQA 188 Saccharophag...
Q0VP97          101 GRSADQQAQFVQVEVYPQALEALFCAACGHTFRVSLDNLNG-EGGDETAFAVKVKAKAERLLAEGLPERPARWCDVLAQA 179 Alcanivorax ...
tigr:TERTU_1125  89 GRSAAQQALFEKVEVKPQALEWIFHKACACRFRVSADNLMA-GMGASSAFKRAILAQVHAYCATGLQARAKHFAAALARY 167 Teredinibact...
WP_010786371     93 GRSAERQREFEQVEVKPQAIEWVLATAANFRYFASVDNLTG-DAGDNSAFKQAVYEQVKIYAEKGLPKRAEQLRQALCEF 171 Glaesserella...
Q9CNG3           83 GRSTAQQRLFEQVEVKPQAIEWILSDAAGFRYFASVDNLSG-EPGDTQPFKQAVYEQVKWYVEKGLPKRAETLRKALCAF 161 Pasteurella ...
P44255           83 GRSEERQRDFEKVEVKPQALEWILATAAGFRYFASADNLNG-NPGDTQPFKQAVYEQVKIYAEKGLPKRAETLRKALVAF 161 Haemophilus ...
Q5ZUA1           82 GRNEEQQTLFQRVEVKPQALEWILSMAAGHKFRVSIDNLNG-TEVDTEAFKQSIYNQVFHYCTQGLPQRALHFRNALCAF 160 Legionella p...
CBJ11604         82 GRNEEQQAMFQCVEVKPQALEWILSKASGYKFHISIDNLNG-AESDTILFKQSVYQQVIHYCKHGLSQRAEKFRVALCRF 160 Legionella l...
SDU:GNIT_2207    94 GRDAEQQARFEAAEVKPQALEYAFSLAAGVKFRVSIDNLQG-DETCSKQFENAVENQLKHFIQLGFNARAQQFLDALHQF 172 Glaciecola n...
3WTR_A          165 YYTP-ELTAEQ 174
Q21LL0          189 FGQShTLNPAh 199 Saccharophagus degradans 2-40
Q0VP97          180 YGRE-GISLQQ 189 Alcanivorax borkumensis SK2
tigr:TERTU_1125 168 FGGEnYLDAda 178 Teredinibacter turnerae T7901
WP_010786371    172 YGTPnHIDLAK 182 Glaesserella parasuis
Q9CNG3          162 YGTPgQIDLAR 172 Pasteurella multocida
P44255          162 YSTEdDINLAK 172 Haemophilus influenzae Rd KW20
Q5ZUA1          161 YRQPsPLRIDD 171 Legionella pneumophila subsp. pneumophila str. Philadelphia 1
CBJ11604        161 YNQPlVLKEKD 171 Legionella longbeachae NSW150
SDU:GNIT_2207   173 YGTA-RLQafn 182 Glaciecola nitratireducens FR1064
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap