Conserved Protein Domain Family
DUF459

?
pfam04311: DUF459 
Protein of unknown function (DUF459)
Putative periplasmic protein.
Statistics
?
PSSM-Id: 398141
Aligned: 2 rows
Threshold Bit Score: 693.404
Threshold Setting Gi: 81344838
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O83576  55 RHKSVKNIYLAFVDPLMHTAEQWGIDTVFPLLRESFLHATGLIQHPEWEDTFYHCEQRSYEPAAALAESVPSPVLQEAVA 134 Treponema pallidum
O83576  55 RHKSVKNIYLAFVDPLMHTAEQWGIDTVFPLLRESFLHATGLIQHPEWEDTFYHCEQRSYEPAAALAESVPSPVLQEAVA 134 Treponema pallidum
O83576 135 VSPPGVAVNDSVAERKTTAPARVFSRTALRILMCGDSQMRYLTGGALQVLGTSSHVQIQEVTVSSSGFVRTDYYHWPRKF 214 Treponema pallidum
O83576 135 VSPPGVAVNDSVAERKTTAPARVFSRTALRILMCGDSQMRYLTGGALQVLGTSSHVQIQEVTVSSSGFVRTDYYHWPRKF 214 Treponema pallidum
O83576 215 LALLDTHTQQEPYAAVIMAFGMNDYQNFYDADGSLCVTKTARWERAYEQKMRACLNIILHTVPKVYLLGMPETRNKQLNE 294 Treponema pallidum
O83576 215 LALLDTHTQQEPYAAVIMAFGMNDYQNFYDADGSLCVTKTARWERAYEQKMRACLNIILHTVPKVYLLGMPETRNKQLNE 294 Treponema pallidum
O83576 295 KLVYIEHVQKKVVAQYDPQRVRYYSLKPIVPGVHGTYASAIRDTHGRWVHVMHKDGIHYTIEGGAYVMETLLPLILADLE 374 Treponema pallidum
O83576 295 KLVYIEHVQKKVVAQYDPQRVRYYSLKPIVPGVHGTYASAIRDTHGRWVHVMHKDGIHYTIEGGAYVMETLLPLILADLE 374 Treponema pallidum
O83576 375 RS 376 Treponema pallidum
O83576 375 RS 376 Treponema pallidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap