1QHL


Conserved Protein Domain Family
MukB

?
pfam04310: MukB 
Click on image for an interactive view with Cn3D
MukB N-terminal
This family represents the N-terminal region of MukB, one of a group of bacterial proteins essential for the movement of nucleoids from mid-cell towards the cell quarters (i.e. chromosome partitioning). The structure of the N-terminal domain consists of an antiparallel six-stranded beta sheet surrounded by one helix on one side and by five helices on the other side. It contains an exposed Walker A loop in an unexpected helix-loop-helix motif (in other proteins, Walker A motifs generally adopt a P loop conformation as part of a strand-loop-helix motif embedded in a conserved topology of alternating helices and (parallel) beta strands).
Statistics
?
PSSM-Id: 398140
Aligned: 8 rows
Threshold Bit Score: 332.149
Threshold Setting Gi: 431830285
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QHL_A            4 RGKFRSLTLINWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGATSGsrDKGLHGKL-K 82   Escherichia...
jgi:Thimo_2687    3 RTHAQTLVLVNWKGVFYERYLIDRHVTALEGANGAGKTTVMIAAYVVLLPDMSRLRFTNLGETGATGG--DKGIWGRLgE 80   Thioflavico...
WP_014292585      5 RGKFQSLTMVNWNGFFARTFDLDQLVTTLSGGNGAGKSTTMAAFIAALIPDLSLLHFRNTTEAGSQSGsrDKGLYGKL-Q 83   Oceanimonas...
WP_015878550      4 RGKFLSFTMINWNGFFARTFELDQMVTTLSGGNGAGKSTSMAALITALIPDQTLLHFRNTTEAGSSSAsrDRGLYGKL-Q 82   Tolumonas a...
WP_011706219      2 RGKFKSLTMVNWNGFFARTFDLDQLVTTLSGGNGAGKSTTMAAFIAALIPDQSLLHFRNTTEAGSSSAsrDKGLYGKL-Q 80   Aeromonas h...
Q65TL9           34 RGKFRSLTLINWNGFFARTFDLDELVTTLSGGNGAGKSTTMAGFVTALIPDLTLLHFRNTTEAGASGGsrDKGLHGKL-R 112  [Mannheimia...
ACQ68429          4 RGKFHSLTLINWNGFFAQTFDLDVLVTTLSGGNGAGKSTVMAAFVTALIPDLTLLHFRNTTEAGATTGsrDKGLHGKL-K 82   Candidatus ...
Q9KRC8            4 RGKYQSLTMINWNGFFARTFDIDNLVTTLSGGNGAGKSTTMAAFITALIPDQSLLHFRNTTEAGSSQAsrDKGLYGKL-Q 82   Vibrio chol...
1QHL_A           83 AGV-CYSMLDTINSRHQRVVVGVRLqqvagrDRK----VDIKPFAIQGLPMSVQPTQLVTETLNErQARVLPLNELKDKL 157  Escherichia...
jgi:Thimo_2687   81 PGRpAYSAIEFALASGQCLIAGVHL------DRKgepsVEPTPFIISGLDTDVRLQDVLLLSQGD-HEVVPELNELRENA 153  Thioflavico...
WP_014292585     84 RGH-CYSLIEVTTSQQERVWFGVHLeqvanrDNK----VNMVPFALQSLAEGAAPTELLLSRLDDgRGQVRSLNELKAAA 158  Oceanimonas...
WP_015878550     83 RGH-CYSMIDVRNSKGQRLWFGVHLeqvanrDNK----VNITPFCMLDVPDSLQPTDFLLEKLDGdKAKVRPFNELRKQA 157  Tolumonas a...
WP_011706219     81 RGH-CYSLLEVMNSREQRIWVGVHLeqvanrDNK----VNITPFALVDVPEQLQPTDLLLEKLDDgKGRVRAFADLKGAA 155  Aeromonas h...
Q65TL9          113 PGV-CYAVLDAVNSRQQRILAGVRLqqvagrDKK----VDIKTFSIQGLEISQNPTAVLTETVSQrQARVLSLTELKDRI 187  [Mannheimia...
ACQ68429         83 AGI-CYCILDVSNSKQQRLLVGVRLqqvsgrDRK----VDIKPFSIQGLSKDIKPTEILTERLGDcQARVISLIELKSRL 157  Candidatus ...
Q9KRC8           83 AGA-CYAALDVVNSRNQRLLFAVKLqqvagrDKK----VDIKPFLIQGLPSHVKPTDVLVETVSDkHARVRQINEVKDAV 157  Vibrio chol...
1QHL_A          158 EAMEGvQFKQFNSITDYHSLMFDLGIIARRLRSASDRSKFYRLIEASLYGGISSAITRSLRDYLLPENSG 227  Escherichia coli
jgi:Thimo_2687  154 ARFGG-RLQIFGTARDYFAALFDHGVTPLRLATDEERNKLNEMLRTSMTGGISRALTSELRSFLLKEETG 222  Thioflavicoccus mobil...
WP_014292585    159 TN-AGlRFARFNTVSEYHNFLFDMGVTPRKLKDQRDRVKFYRLIEASLYGGISSTISRSLKDYLLPENAG 227  Oceanimonas sp. GK1
WP_015878550    158 AELGAiRFVKFNSVTDYHNVMFEYGVTAKKLRDQRDRSRFYRLIEASLYGGISSSISRSLREYLLPENSG 227  Tolumonas auensis
WP_011706219    156 AELGAlKVAKFNTVTDYHNFMFEFGITPKKLRDQKDRGKFYRLIEASLYGGISSSISRSLREYLLPENSG 225  Aeromonas hydrophila
Q65TL9          188 EE-QGaQFKQYHSVADYHAMMFELGMIPRRLRSSSDRSKFYKLIEASLYGGISSAITKSLRDYLLPENLG 256  [Mannheimia] succinic...
ACQ68429        158 EKQEGaEFKQFQSIMDYHSFMFDMGIIPKRMRSSADRSKFYRLIEASLYGGISTAITRSLRDYLLPENIG 227  Candidatus Hamiltonel...
Q9KRC8          158 GQIEGaHFKSFPSIVDYHAQMFEFGVIPKKLRNSSDRSKFYRLIEASLYGGISSAITRSLRDYLLPQNGG 227  Vibrio cholerae O1 bi...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap