Conserved Protein Domain Family
DUF455

?
pfam04305: DUF455 
Protein of unknown function (DUF455)
Statistics
?
PSSM-Id: 398135
Aligned: 155 rows
Threshold Bit Score: 188.866
Threshold Setting Gi: 336482926
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011390384     265 NTSDPVGKVEYTRMAAKAFRSG-ECklIgggqwhtsdastGrrewitkpqeTAP-E---RPPRSKEEVRVRPGQEGkRGR 339 Ustilago ma...
XP_006852484      89 STSDPITKARLSHHAYTLWREN-DLclG-------------------------VwEppdRPARPPKPHLVSPKEVP-DPK 141 Amborella t...
XP_009110998      91 STSDPLSKSHISHLAFSRWRREnNLpvG------------------------SIsNlpsSPSRPPKPLLVPTNEVP-SPK 145 field mustard
KRH27021          98 STSDPHWKSQLSHMAYSMWRRH-NLplG-------------------------IsKppsRPARPPIPQLVSPKEIP-APK 150 soybean
XP_009381762     101 SSSDPLAKSTLSHLAYTRWCRR-EIlvG-------------------------TaSpphRPARPDRPLLVPPKEVP-SHK 153 wild Malays...
XP_015694801       7 STADPLAKARLTHAAFTRWVAG--LpvG-------------------------LaGapdHPARPDKPIVVTQKEIT-THK 58  malo sina
XP_005849745     113 LSADPRRKAALTFAAWRAFKAG-TLpiG------------------------TAdPlegPPARPAKPELVPPRQIP-SMD 166 Chlorella v...
XP_001419330      57 ATACPREKARLSHVAYGLLVRG-KIdiAda---------tT-----------RAsDmptRPARPAKPRLVPPKEVP-SPK 114 Ostreococcu...
jgi:MICPUN_69427  12 RTADPAMKAALSHAAYAKFVNSrga------------------------mrVGVaSppaAPARPELPTLVEPKLVP-SPK 66  Micromonas ...
EEH56793         150 RTADPAIKAALSHRAYAAFVAAededededg-----------gaarrrrmkIGRaSppdAPARPTRPTLVHPKDVP-SPK 217 Micromonas ...
XP_011390384     340 GGTEKSRIAILHSLANIEQWAIDLAWDMIARApqlcarffgdanadadadqdacpvtRKLP------LQFFSDFVKVAED 413 Ustilago ma...
XP_006852484     142 NSGLPLNAYMLHNLAHVELNAIDLAWDTIVRFss---------------------fqEALG------TGFFSDFAHVADD 194 Amborella t...
XP_009110998     146 DSDLPLNAYMLHNLAHIELNAIDLAWDTVARFsp---------------------ffDVLG------RRFFDDFAHVADD 198 field mustard
KRH27021         151 DSGLPLNAYMLHNLAHVELNAIDLAWDTVVRFsp---------------------ysEILG------EGFFADFAHVADD 203 soybean
XP_009381762     154 SSGLPLNAYMLHNLAHVELNAIDLAWDTVVRFsh---------------------lrDELG------DEFFADFARVADD 206 wild Malays...
XP_015694801      59 QMGVPLNAYMLHMLAHVELNAIDLAWDTVVRFsp---------------------lrDTLG------DGFFADFARVADD 111 malo sina
XP_005849745     167 KSTLPKSVYMLHNLTHVELNAVDLAWDTVVRFs-----------------------aFGLP------ADFYSDFARVADD 217 Chlorella v...
XP_001419330     115 NSPLGAAAHAMHTVTHIELNAIDLAWDTVGRFad---------------------lrGALP------DQFFVDFAHVADD 167 Ostreococcu...
jgi:MICPUN_69427  67 TCELGMSAAMIHNVAHIELNAIDLAWDTVARFsrlaaddg----------tavddagTAVP------TEFFADFARVADD 130 Micromonas ...
EEH56793         218 TCELGMSAAMMHNIAHIELNAIDLAWDTVARFsalaaaddd--------dadeddasTSSPrrfvvpMDFFRDFARVADD 289 Micromonas ...
XP_011390384     414 EAKHFSLLSKRLQEMGSYFGALPVHHGLWDSAMETAHSLTARLSIIHLVHEARGLDVNPTTIKKFANAGDAQSVETLTVI 493 Ustilago ma...
XP_006852484     195 ESRHYLWCSERLAELGFSYGDMPAHNLLWRECEKTSGCVAARLAVIPLVQEARGLDAGPRLVKKLVGFGDNRTSSIVAKI 274 Amborella t...
XP_009110998     199 ESRHFMWCSQRLAELGFKYGDMPANNLLMRECENTSNNVAARLAVIPLVQEARGLDAGPRLVKRLMGFGDHRTSKIVAKI 278 field mustard
KRH27021         204 ESRHFSWCAQRLAELGFKYGDMPAHNLLWRECEKSSDNVAARLAVIPLVQEARGLDAGPRLVKKLVGFGDNRTSKIVARI 283 soybean
XP_009381762     207 ESRHFAWCSQRLNELGFRYGDMPAHNFLWRECEKSSEDVAARLAVIPLVQEARGLDAGPRLTQKLVGFGDHRTSHIVAKI 286 wild Malays...
XP_015694801     112 ESRHFRWYSQRLTELGFSYGDMPVHNLLWRECAKSSSDVSARLAVIPLVQEARGLDAGPRLVHKLLGFGDHRSADIVNKV 191 malo sina
XP_005849745     218 ESRHLSWCLQRLEELGFEYGCMPAHDLLWEGCQLSQHDLGARLAVVPMGQEARGLDAGDRLAKRLVGMGDNRTAAIVRRI 297 Chlorella v...
XP_001419330     168 ESRHLLWCLQRLEELGVAYGDVAAHDVLWEGCEATRDDPLARLAVVPCMQEARGLDAGPRLVERLVGHGDARSAAIVARI 247 Ostreococcu...
jgi:MICPUN_69427 131 ESRHLGWCLQRLGEMGVRYGDIPAHNVLWEGAQATASSLPARLAVVPCMQEARGLDAGPRLVAKLQGRGDNRSAAVVRRI 210 Micromonas ...
EEH56793         290 ESRHLGWCLQRLSELGVAYGDIPAHNG----------SLAGRLAVVPCMQEARGLDAGPRLASKLQGRGDNRSAAMIARI 359 Micromonas ...
XP_011390384     494 HLDEITHVSAGHRWMTWLC-SNAQPr-lD-P-----VQVFRHEVRKNFIGRLKGPFNAEDRRKAGLDKAWYD 557 Ustilago maydis 521
XP_006852484     275 AEEEVQHVSVGVFWFVSVC-AKMGC---T-P-----DVIFKDLLKEYNV-ELKGPFNHAARDEAGIPRDWYD 335 Amborella trichopoda
XP_009110998     279 AEEEIAHVAVGVDWFLSVC-QKMNR---A-P-----CPTFKDLIKEYGA-ELRGPFNHSAREIAGIPRDWYD 339 field mustard
KRH27021         284 ADEEVAHVAVGVYWFASVC-EKLNC---A-P-----DSTFKDLLKEYNV-ELKGPFNYSARDEAGIPRDWYD 344 soybean
XP_009381762     287 AEEELAHVAVGLYWFLQVC-KKMGR---I-P-----RAIFKDLLEEYGV-ELKGPFNYAARDEAGIPRDWYD 347 wild Malaysian banana
XP_015694801     192 AEEELAHVSVGLHWFLKVC-QMMGR---V-P-----DATFRDLIKEHDV-VLKGPFNYSARDEAGIPREWYE 252 malo sina
XP_005849745     298 ATEERAHVAVGVAWFSRIC-AALGV---E-P-----GPSFQKLLLTLTPGLLKGPYNDAERQEVGLPQQWYf 359 Chlorella variabilis
XP_001419330     248 SEEEIAHVAVGATWFRTVC-AALGDdddDaRaddvaAATFRAYIQRLAPDALRGPFNHDDRARAGIDPSWYA 318 Ostreococcus lucima...
jgi:MICPUN_69427 211 SEEEIAHVAVGVAWFRHVCgGALGG---VdP-----GDAFRAHIGVHAPDALRGPFNHEQRVAAGLEPDWYS 274 Micromonas commoda
EEH56793         360 SDEELAHVAVGVAWFRELC-GALRV---D-P-----GDAFRAHVGEHAPESLRGPFNHSARIAAGLEPNWYS 421 Micromonas pusilla ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap