Conserved Protein Domain Family
DUF454

?
pfam04304: DUF454 
Protein of unknown function (DUF454)
Predicted membrane protein.
Statistics
?
PSSM-Id: 398134
Aligned: 253 rows
Threshold Bit Score: 68.595
Threshold Setting Gi: 387857734
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3JC29           1 MWLYRIIGFFFIGIAIIGAILPLLPTTPFLLLAAGCFAKSSPKFHQMLLENAIFGPIIKNWHEHKTISLRTKIIAISSLL 80  Nitrosococcus...
jgi:Turpa_0471  33 RYVYILLGVISLVLGIVGVVTPILPTTPFILLSGFCFARGSERLHDWMLGHRYFGPMIKAFRDERRIPFKVKIFATLMIA 112 Turneriella p...
jgi:Plim_2214   67 RIVFQVGGVSCIGLAIAGVFLPVLPTTPFLILASFLFYRSSPELYLRLHQHRFSGPLLRKWERDRGVSFRVKMGAVGIVL 146 Planctopirus ...
jgi:Hbal_0894    7 RFLWMICGFVALALGVAGIILPLLPHTVFLLIAAFCFSRGSERLHSWLINHKHLGPPIRDWNEHGAIPLKAKIIASIMMA 86  Hirschia balt...
Q3IYH8           2 RLLWVSAGLAALGLGVLGIFLPLLPTVPFLLLAAFCFARSSERLHSWLIHHPVLGPPIRDWERSGAISLKGKQMATLSML 81  Rhodobacter s...
Q5LWF9           2 QFIWAALGLVCVALALIGVALPLLPTVPFLLLAAFFFARSSERLHTWLVTHRLFGPMILDWQQSGAIRPGAKKAATLSIA 81  Ruegeria pome...
Q1GCL5           2 RFIYLCLGLTSVLLAGVGVVLPLLPTVPFLLLAAFFFARSSERLHDWLLSHATFGPMILDWNERGAIGPSAKKAATLSVA 81  Ruegeria sp. ...
WP_014881531     2 RLLYAALGLLCVGLALVGVALPLLPTVPFLLLASFFFANSSERLHDWILNHRLFGTMIQDWHERGAIRPAAKKAATFSVA 81  Phaeobacter i...
jgi:Dshi_3459    2 RAIWVISGSTALGMGVIGIALPLLPTVPFLLLAAFCYARGSDRLHAWLLDHPRLGAPILGWQERGSISLRAKGLASLSIL 81  Dinoroseobact...
Q6FC73          33 RWVFIGLAWLCIALGILGIFIPGLPTVDFIILAVFFAARGSEKLHQWFRNHRYIGPLIREWQEHRRISKKAKYISTLSMS 112 Acinetobacter...
Q3JC29          81 FFGGYSVIF----------AIenttlkVVGILAITIGLFSvIRIkthpihPP 122 Nitrosococcus oceani ATCC 19707
jgi:Turpa_0471 113 ITMSITAIFvvpl---lavKL------GMAAVGLGVVWYI-WTF------RN 148 Turneriella parva DSM 21527
jgi:Plim_2214  147 LMVALTLLSgrisspmhwlIM------GLASIGIMVILLL----------PS 182 Planctopirus limnophila DSM 3776
jgi:Hbal_0894   87 ATLGTAYLFhap----npvII------AQIIILPLVGLFI-WSR------PS 121 Hirschia baltica ATCC 49814
Q3IYH8          82 AVFGISVGLglr----ptiLA------VQAAALCASGLFI-WTR------PS 116 Rhodobacter sphaeroides 2.4.1
Q5LWF9          82 AVFGLSLVFavp----shvLL------IQAVVLSGVLIFI-WTR------PN 116 Ruegeria pomeroyi
Q1GCL5          82 AVFSISIILnvp----thvLL------IQGLTLGGVMIFI-WSR------PN 116 Ruegeria sp. TM1040
WP_014881531    82 AVFGLSVILsap----shvLI------IQAITLSAVMIFI-WSR------PN 116 Phaeobacter inhibens
jgi:Dshi_3459   82 GAFSLSLVLgvs----ttvLT------VQAAVLSIVAVFI-WTR------PS 116 Dinoroseobacter shibae DFL 12 = DSM 16493
Q6FC73         113 LAAGLMIWTiph----pwfVY------PAILCMAGVLAWM-WLK------HD 147 Acinetobacter baylyi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap