2H9F,6OTV


Conserved Protein Domain Family
PrpF

?
pfam04303: PrpF 
Click on image for an interactive view with Cn3D
PrpF protein
PrpF is a protein found in the 2-methylcitrate pathway. It is structurally similar to DAP epimerase and proline racemase. This protein is likely to acts to isomerise trans-aconitate to cis-aconitate.
Statistics
?
PSSM-Id: 398133
Aligned: 5 rows
Threshold Bit Score: 533.666
Threshold Setting Gi: 1653017423
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H9F_A   7 QIRIPATYLRGGTSKGVFFRLEDLPESCRVPGEARDRLFXRVIGSPDPYAAHIDGXGGATSSTSKCVILSKSSQPGHDVD 86  Pseudomonas aeruginosa
Q9KSB9   7 QIRIPATYMRGGTSKGVFFRLNDLPLEAQLPGAARDALLLRVIGSPDPYGKQIDGMGGATSSTSKTVIVSASSRTDHDVD 86  Vibrio cholerae
Q9PDY6  22 QCRIPATYLRGGTSKGVFFRLEELPPACRVPGPARDALLLRVIGSPDPYGKQIDGMGGGSSSTSKVVIIAPSAYPNHDVD 101 Xylella fastidiosa
O07931   1 MVKTNVTIMRGGTSKGVFFHESAMPNNK----NEWEPFLLDVMGSPDKR--QIDGLGGGNSLTSKVAIIKKAYTSDIDVH 74  Bacillus subtilis sub...
6OTV_B   1 MKKIPCVMMRGGTSRGAFLLAEHLPEDQ----TQRDKILMAIMGSGNDL--EIDGIGGGNPLTSKVAIISRSSDPRADVD 74  Escherichia coli K-12
2H9F_A  87 YLYGQVSIDKPFVDWSGNCGNLSTGAGAFALHAGLVDPARIPEDGICEVRIWQANIGKTIIAHVPVSGGQVQETGDFELD 166 Pseudomonas aeruginosa
Q9KSB9  87 YLFGQVAIDKPFVDWSGNCGNLSAAVGPFAIHAGLIPAECIPHNGVVAVKVWQVNISKTIVVHVPIVNGAVQECGEFELD 166 Vibrio cholerae
Q9PDY6 102 YLFGQVAIERACVDWTGNCGNLSAAVGPFAIAAGIVDPARVPHRGICSVRIWQANIGKTIVAHVPIIDGQVQESGDFMME 181 Xylella fastidiosa
O07931  75 YTFGQVSISEEKVDFKGNCGNISAAVGPFAIEEGLV-KAKEP---MTAVRILNTNTNKMIIAEVEVEDGQVKYDGDVTIS 150 Bacillus subtilis sub...
6OTV_B  75 YLFAQVIVHEQRVDTTPNCGNMLSGVGAFAIENGLI-AATSP---VTRVRIRNVNTGTFIEADVQTPNGVVEYEGSARID 150 Escherichia coli K-12
2H9F_A 167 GVTFPAAEIVLEFLDPSDDGedgGAIFPTGNLVDDLEVPGVGTFKATXINAGIPTVFVNAEEIGYRGTELREEINGDPQQ 246 Pseudomonas aeruginosa
Q9KSB9 167 GVTFAAAEVQVDFVDPADDS---GAMFPTGNVMDDLQVPGIGTLNATFINSGIPTIFVDAEALGYQGTELQEAINSDPQA 243 Vibrio cholerae
Q9PDY6 182 GAAFPGAEVRLEFFNPADVGg-dRAMFPTGHLIDTLEVPGLGPIEATLINAGIPMLCVDAHALGYTGTELQEAINGDPHA 260 Xylella fastidiosa
O07931 151 GVPGSGSPIYLNFHDAAGSVt--GHLLPTGNSSEFLDTSQ-GQIEVSIIDYANPLVFVEASSIGLDGTELAEEFT-DLQ- 225 Bacillus subtilis sub...
6OTV_B 151 GVPGTAAPVALTFLNAAGTKt--GKVFPTDNQIDYFDD-----VPVTCIDMAMPVVIIPAEYLGKTGYELPAELDADKAL 223 Escherichia coli K-12
2H9F_A 247 LARFERIRVAGALRXGLIKTPEEAATRQHTPKIAFVAPPRDYRTASGKLVAAGDIDLLVRALSXGKLHHAXXGTAAVAIG 326 Pseudomonas aeruginosa
Q9KSB9 244 LAKFETLRAYGALKMGLIERIEEAQNRQHTPKIAFVSGAKSYLASSGKRVEADSVDLLVRALSMGKLHHAMMGTAAVAIA 323 Vibrio cholerae
Q9PDY6 261 LVCLETLRAYGALRMGVIGHLEDMVQHQHTPKLAFVAPPADYVASGGRHVHATEIDVLVRAMSMGRLHHAMMGTAAVALG 340 Xylella fastidiosa
O07931 226 LAQFEELRSIAAEKCGFASRFSATKLSPAVPKLAIVAKPEKYKDSTGAWHSSVEMDLHIRMMSMQKPHQALAVTGAICTT 305 Bacillus subtilis sub...
6OTV_B 224 LARIESIRLQAGKAMG-LGDVSNMV----IPKPVLISPAQ----KGG------AIN--VRYFMPHSCHRALAITGAIAIS 286 Escherichia coli K-12
2H9F_A 327 TAAAIPGTLVNLAAGGGERSAVRFGHPSGTLRVGAEASQANGEWTVTKAIXSRSARILXEGWVRVP 392 Pseudomonas aeruginosa
Q9KSB9 324 SAAAVPGTLVNLAAGGGERTSVTFGHPSGTLKVGAKAKQGKQGWQIERAIMSRSARILMEGWVRVP 389 Vibrio cholerae
Q9PDY6 341 TAAAIPGTLVNRAAGGGLRRVVRFGHPSGTLQVGAEVHQVDGQWSVSNVRMSRSARVLMEGWVRVP 406 Xylella fastidiosa
O07931 306 RALSVEGAIPARIAKNHS-TKVRLAHSSGIIETMVEPTG---------IKIVRTARRIMDGTVYTH 361 Bacillus subtilis subsp. subtilis s...
6OTV_B 287 SSCALEGTVTRQIVPSVGYGNINIEHPSGALDVHLSNEGQDA--TTLRASVIRTTRKIFSGEVYLP 350 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap