5B4N


Conserved Protein Domain Family
FBA

?
pfam04300: FBA 
F-box associated region
Members of this family are associated with F-box domains, hence the name FBA. This domain is probably involved in binding other proteins that will be targeted for ubiquitination. FBXO2 is involved in binding to N-glycosylated proteins.
Statistics
?
PSSM-Id: 398132
Aligned: 70 rows
Threshold Bit Score: 148.121
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5B4N_A         25 LSKRRRNLLRN---PCGEEDlEG---Ws--lDVNGGDGWKVEelsrdqRKEFP-NDqvK-----KYFVTSYYTCRKAQVI 90 
14_pfamImport   3 RRPIGQNLIQN---LKGk-------------GKEPRKG----------------------------------WHHKKKVV 32 
XP_011986704  207 RRPIGRNLLRK---PRGLGGfQK---Wt---VLSREDDWTEKe----nLEVMP-RAymQ-----TSFLSSYRRYHKKQVL 267 mouflon
13_pfamImport   3 RRPIGRNLIQN---PKG-EGfLK---Wt---VLTSEDGWAEEde---dLKLIP-RGcmL-----TSFQSAYWWYHKKQVV 63 
DAA28825      131 RRPLGRNLYPN---PHGIDAfLP---Wr--tINCT--SWREEesweedHRLVP-EDs---------FQPFYRWCYKKQAL 190 cattle
10_pfamImport   3 RRPLGRNLYPN---PHGIGC--P---WdgleVRGR--DERLQe----tPGTYP-RAgrQarnlgTNIFSFNRWCYKKQVL 67 
ELR60130       83 RRPIGSKLTAN---PVGKDL------Wnc-mVLSGSDSSEEEe----dLGARL-KTsgE-----TSYSPAYRCWYKGEIL 142 wild yak
XP_014962117  120 RRPIGRNLLRNsqsSRG-LGfLN---Qt---VPSAEAARGAEe----nARVGPlTAyrQ-----RRLLSSYRWCQQKQVL 183 mouflon
XP_020953200  112 RRPIGQNLIQN---LKGkeafldwfvlreeaALVLEENWRVT--------LNR-SVhwQ-----DCFLSAYRWHHKKKVV 174 pig
XP_011763152  109 RRPIGRNLIrnp----cgQGlRK---Wm---VQHGGDGWVVEe----nRTTVP-GApsQ-----TCFVTSFSWCRKKQVL 168 pig-tailed mac...
5B4N_A         91 DLQAEGYWEELLDTTQPAIVVKDWYSGRPDCGSKYQLTVRLLSENEDVLAEFQPDPATiQQKSDAKWR----EISHTFID 166
14_pfamImport  33 DLEEEGLWPELLDSGKLEICVSDWWTDKQCTDCLYCLTVQLLDANQGVLHQFAPLPQP-----DGTHPflclQVSHVFSN 107
XP_011986704  268 DLEKEGLWRELLDSGNIEICVSDWRNDRQGIDCIYQLTVHLLDASQAILDHFSPLPFPiRRSRNSVSS----RASHVFSN 343 mouflon
13_pfamImport  64 DLEEEGLWPELLDSGKLEICISDWRNDQQGTDCLYQLCVQLLDAEKAILDHFSPVPFPiLKWINSVSS----QVSHVFSN 139
DAA28825      191 DLEKEGLWPELLDSGKIEICVSAWWANQEASVCLYELIVQLLNAKQAKLHHFSPRPIH--QGTTSIPF----KTNHVFSN 264 cattle
10_pfamImport  68 DLEEEGLWPELLDSGKIEICVSARWADQEASVCLYELIIQLLDAKQAKLHHFS--PRLiHQGTTSIPF----KTDHLFCN 141
ELR60130      143 DLEEEGLWQELLDSGKIWISVCRRWTEQQGSDRMYQLVVKLLDANYAILHYFFHKRFPvRPRTGSFSF----RIMHAPHN 218 wild yak
XP_014962117  184 DLEKEGLWRELLDSGNIEIRVSDWWFDDRDADCLYRLIVQLLDANQAVLHHFSPLPFPsNQLGNDVFF----EVNHVFSN 259 mouflon
XP_020953200  175 DLEEEGLWPELLDSGKLEICVSDWWTDKQCTDCLYCLTVQLLDANQGVLHQFAPLPFPreqrkyrvffkvslwqgcgewt 254 pig
XP_011763152  169 DLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPiPQWNNNACL----HVTHVFSN 244 pig-tailed mac...
5B4N_A        167 yGPGVRFVRFEHGGVDtHYWAGWYGPRVTNSSVW 200
14_pfamImport 108 lKKGVRFVSLEHWIRDmRFLSEQYGVYLCNSSVI 141
XP_011986704  344 iKKGVRFVSFERHIWDlEFRNEQYGVSLMNSSVI 377 mouflon
13_pfamImport 140 lKKGVRFVSFEQWVWNlELGNEQHGLSLTNSSVI 173
DAA28825      265 lKKGVCFVSLEHWIWDmGFLPEDYGIIVPKASVI 298 cattle
10_pfamImport 142 lKRGVRFVSLEHWIWDmGFLPEDYGIIVPKASVI 175
ELR60130      219 iKKGVRFVLFDHSVEGyDSWPEQCGVCRPQSSVI 252 wild yak
XP_014962117  260 lKKGVRFVSFEHWIRDfEFSHEQHGNYPLHSSMT 293 mouflon
XP_020953200  255 vgsgviygcitncpqlswlgvnssdfitslvpfr 288 pig
XP_011763152  245 iKMGVRFVSFEHWGQDtQFWAGHYGARVTNSSVI 278 pig-tailed macaque
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap