3RPU


Conserved Protein Domain Family
MukE

?
pfam04288: MukE 
MukE-like family
Bacterial protein involved in chromosome partitioning, MukE
Statistics
?
PSSM-Id: 398124
Aligned: 15 rows
Threshold Bit Score: 387.911
Threshold Setting Gi: 500025502
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3RPU_D           21 MPVKLAQALANPLFPALDSALRSGRHIGLDELDNHAFLMDFQEYLEEFYARYNVELIRAPEGFFYLRPRSTTLIPRSVLS 100
Q7N6B8            1 MPVKLAQALANSLFPELDSQLRAGRHIGIDDLDNHAYLMDFQEQLEEFYARYNVELIRAPEGFFYLRPRSTTLIPRSVLS 80  Photorhabdus...
WP_004235837     10 MSAKLAQALANNLFPELDSQLRAGRHIGVDDLDNHAFLMDFQDELEGFYARYNVELVRAPEGFFYLRPRSSTLIPRSVLS 89  Morganella
CAR41701         17 IPAKLAQALANSLFPELDSQLRAGRHIGIDSLDNHAFLMDFQDELTDFYARYNVELIRAPEGFFYLRPRSTTLIPRSVLS 96  Proteus mira...
ACQ68428          1 MPVKLAQALSNPLFPNLDSQLRSGRHVGMDELENHCFLMDFQEPLETFYRRYHVELIRAPEGFFYLRPRSSTLIPRSVLS 80  Candidatus H...
USMARC:WQG_9870  18 ISTKLAQAIANPIFPSLDSQLRAGRHISLEHLDEHAFLMDFQAELEQFYRRYHVELIRAPEGFFYLRPKATTLIARSAMS 97  Bibersteinia...
B0UU63            9 lSIKLARAIANPLFPEVDSQLRSGKHIGQEYLDNYSFLADFQHELDSFYRRYNVELIRAPEGFFYLRPKATTLIARSVLS 88  Histophilus ...
Q9KRC7            1 MPENLAKAIANPLFPALDSLLRAGRHVSSDDLDNHAFLSDFEPDLALFYQRYHTELVRAPEGFFYLRPRSTSLINRSVLS 80  Vibrio chole...
Q6LPL4            1 MPEKLAKAIANPLFPALDNALRSGRHVSSEDLDNHALLIEFERELGMFYRRYNTELIRAPEGFFYLRPRSTSLIGRSVLS 80  Photobacteri...
P45186            8 ISPKLAVAIANPIFPAVDSLLRSGRHISTEHLDNHAFLMDFQNELDGFYRRYNVELIRAPEGFFYLRPKATTLIARSVLS 87  Haemophilus ...
3RPU_D          101 ELDMMVGKILCYLYLSPERLANEGIFTQQELYDELLTLADEAKLLKLVNNRSTGSDVDRQKLQEKVRSSLNRLRRLGMVW 180
Q7N6B8           81 ELDMMVGKILCYLYLSPERLANQGIFTAQELYEELISLADEGKLMKFVNQRSSGSDLDKQKLQEKVRTTLNRLRRLGMVY 160 Photorhabdus...
WP_004235837     90 ELEMLVGKVLCYLYLSPERLANQGIFSTAELYEELLSLADEAKLLKVVNNRSTGSDLDKQKLLEKTRGALNRLRRLGMIT 169 Morganella
CAR41701         97 EMDMLVGKILCYLYLSPERLANQGIFTVQELFDELRTLADESKLLRLVNQRSTGSDLDLQKLQEKMRTSLNRLRRLGMIS 176 Proteus mira...
ACQ68428         81 ELDMILGKILCYLYLSPERLNNQGIFSEQELYEELITLSDEKKLFKCINQRSTGSDLDKQKLQERVRTSLNRLRRLGMVY 160 Candidatus H...
USMARC:WQG_9870  98 EMEMLVGKVLCYLYLSPERLAQQGIFSYDDVYDELLNLADESKLLKAINPRSTGSDLDKAKLQERVGGALRRLARIGIVT 177 Bibersteinia...
B0UU63           89 ELEMLVGKVLCYLYLSPERLAQQGIFTVQEVHDELINLADETKLLKAINLRAGGSDLDKQKLAEKVRSAISRLRRLGMIH 168 Histophilus ...
Q9KRC7           81 ELDMLVGKVLCFLYLSPERLAHEGIFTNQELYDELLTLVEEKKLMKLVTNRASGSDLDREKLFEKVRTSLRRLRRLGMVI 160 Vibrio chole...
Q6LPL4           81 EIDMLVGKVLCFLYLSPERLAHEGIFTNQELFDELLVLADEKKLMKFVTHRASGSDLDREKLYDKVKTSLRRLRRIGMLI 160 Photobacteri...
P45186           88 ELEMLVGKVLCYLYLSPERLAQQGIFSTQEVYDELLNLADEGKLLKAVNQRSSGSDLDKQKLAEKVRAAIGRLRRLGMIQ 167 Haemophilus ...
3RPU_D          181 FM-GHDSSKFRITESVFRFGADVRAGDDPREAQRRLIRDGEAMP-----IENHLQLNDETEENQPDSGE 243
Q7N6B8          161 IL-PNDNNKFTITEAVFRFGADVRSGDDPREVQLRMIRDGEAMP-----IEGGLSLDDSENDETSDNSA 223 Photorhabdus laumondii ...
WP_004235837    170 FV-SADNSQFVIAESVFRFGADVRSGDDPREAQLRLIRDGEAQSlt--eDEKYPRPEDQDDDNEESDND 235 Morganella
CAR41701        177 FL-PNDTQRFSITESVFRFGADVRSGDSPLEAQMRMIRDGEAMP-----LEQDSEPSDDDEQEDEQLES 239 Proteus mirabilis HI4320
ACQ68428        161 FI-ENDKQKFVINAAVFRFGADIRHDEDLPAAQLRLIQQGEAVDll--nPEKMQVFTPNDLPDETPNEH 226 Candidatus Hamiltonella...
USMARC:WQG_9870 178 RVgEQNSKKFIISESVFRFGADVRTGDDPREAQLRLIRDGEATTpe-llSQQALELAENSANSEENEQD 245 Bibersteinia trehalosi ...
B0UU63          169 AVgDQHSGKFTISESVFRFGAEVRSGDDPLEAQLRLIREGEAATaq-slQEEKNGLKDNMDQSAVENEQ 236 Histophilus somni 2336
Q9KRC7          161 TI--GDTGKFRITEAVFRFGADVRLGGDVREAQLRLIRDGEAVVht-pePSQQSLLE-NPTAEYDEEQT 225 Vibrio cholerae O1 biov...
Q6LPL4          161 PI--GENGKFRISESVFRFGADVRTGDDVREAQLRLIRDGEAVVhq-qePSQSSLLDGFDADDTGHHDS 226 Photobacterium profundu...
P45186          168 TVgEQNSGKFTISESVFRFGAEVRSGDDPLESQARLIRDGEAATpdslaLEKQAQLMENDTKSADEIDE 236 Haemophilus influenzae ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap