Conserved Protein Domain Family
DUF438

?
pfam04282: DUF438 
Family of unknown function (DUF438)
Statistics
?
PSSM-Id: 398118
Aligned: 79 rows
Threshold Bit Score: 69.4414
Threshold Setting Gi: 363406891
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8DQU9          9 LRDILLELHNGASPESVQDRFDATFTGVSAIEISLMEHELMnSDSgVTFEDVMELCDVHANLFKNAIKG 77  Streptococcus pneumoniae R6
jcvi:BFO_2632  15 LRHLLLRLHEGDNPDVLRNRLVEVLSSIPYNEVVEVEQELI-ESGaLSEDEILAFCDLHTAVLDGSIDQ 82  Tannerella forsythia 92A2
Q023D6         15 LKGIIKRLHAGDAPDEVRNSLKELVCQTDYSEVMAMEQELI-ADG-MPVEEIQGMCDLHSQVTREVLVQ 81  Candidatus Solibacter usi...
Q2IEF0         15 LKEIILHLHRGEAPAAVRGRLAALIADVDASEVAAMEQELM-AEG-MSHQEVQSLCDLHADVLQDVMTR 81  Anaeromyxobacter dehaloge...
WP_012583929   15 LKELIRKIHKGEDPEKLKTRFKDIFGSVTTTEIAEIEQELI-QEG-MPREEVMRLCEIHLKVFEEALEK 81  Dictyoglomus turgidum
WP_014826124   15 LKQIIRDIHQNKNPQELKERFRELLSDVGATEIAALEQELI-QEG-LPEKEIQSLCDVHVSVFQDSLDQ 81  Desulfosporosinus acidiph...
WP_014903988   91 LKEIIRDIHRQEDPAELRERFKDLLRDVGATEIAQLEQELI-QEG-LHETEIKSLCDVHAAVFEEGLNN 157 Desulfosporosinus meridiei
WP_013840994   15 LKDIIRDLHKGKDPDEVKERFQSLIKDVDATEIANMEQSLI-QEG-ISPEEITKLCDVHAAVFKDALME 81  Desulfotomaculum ruminis
WP_011878963   15 LKTIIKDLHQGKDFNQVKADFQNLIKDIDASEIANMEQALI-GEG-MNPEEITKLCDVHAAVFRDALEE 81  Desulfotomaculum reducens
WP_006523934   15 LKRLITDLHNGRDFNAVKKEFGDLVEGVEATEIADMEQQLI-KEG-LPPEEIKKLCDVHAALFRDTLDK 81  Desulfallas gibsoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap