6JNF


Conserved Protein Domain Family
Tom22

?
pfam04281: Tom22 
Mitochondrial import receptor subunit Tom22
The mitochondrial protein translocase family, which is responsible for movement of nuclear encoded pre-proteins into mitochondria, is very complex with at least 19 components. These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family represents the Tom22 proteins. The N terminal region of Tom22 has been shown to have chaperone-like activity, and the C terminal region faces the intermembrane face.
Statistics
?
PSSM-Id: 398117
Aligned: 84 rows
Threshold Bit Score: 108.82
Threshold Setting Gi: 170089347
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6JNF_C         1 MVELTEIKDDVVqlDEPQFS---RNQAIVEEKASAtnndVv-----DDEDDS---DS---DFEDEFdENETLLDRIVALK 66 
EKD02659       1 MVLVEEVKEEIIvdRESDYE--------------------------TESEFSeddAEsviSEDDFDpSTETFADRVAALK 54  Trichosporon as...
KDE06291       1 MVQIQDVTNEDAwsDASSNAsddSRSAAQRP----------------GAGLDsddDDddlSLTAFDaSTESFSSRFYALK 64  Microbotryum ly...
EFI98978       1 MVQVEIVDEKd------------PQYASDe---------------sSAADSDddlES---VTSDDDeRDETLLDRIAALK 50  Schizophyllum c...
XP_001875896   1 MVKVEIVDEK---------EigqSPYASSs---------------dSRTSSSasiSS---VESDISv-DESFFDRVAALV 52  Laccaria bicolo...
XP_001835684   1 MVKVEIVDDK---------DegnYPYASSs---------------sSRTNSTdslSS---VESDLSv-DETFAERLAALV 52  Coprinopsis cin...
CEL51786       1 MVKVEEIRDKe---YRSSSPygsSEYSSSs---------------dSVASSSsslST---ASSPD---QETLGQRLAALV 56  Rhizoctonia sol...
XP_007845660   1 MVKVEIVDEKeq----------nSPYLSDs---------------dARTASTdslSS---VESDLSa-DETFFDRVSALV 51  Moniliophthora ...
CCU97428       1 MVRIEEVQDESEkiRQQDLDl-------SNDNEDDe---WeatdaeTDDDLSdddDV---EERALVlANESIWDRIAALK 67  Malassezia symp...
XP_001730341   1 MVRIEEVQDETEklRQQGLS--------TEKDDDDe---WeatdadSDEDDLsddEV---EERGLVvANESFWERISALK 66  Malassezia glob...
6JNF_C        67 DIVPPGKRQTISNFFGFTSSFVRNAFTKSGNLAWTLTTTALLLGVPLSLSILAEQQLIEMEKTFDLQSDANNILA 141
EKD02659      55 DIVPPETRKSLANTAETIKSWSSSAYNLSGNIAWWVCTSAILVALPLALASENEAMITQQERELQMQSTGQQqhe 129 Trichosporon asahii ...
KDE06291      65 DMIPPSTRASLHNSAATLHSWAWSLGTLGGSAAWIACTSAILVGLPLMLAIEGEAGLVQQELQYMGQQAAtpqaq 139 Microbotryum lychnid...
EFI98978      51 DIVPPSTRLAVANNVSKAGSFVKGTGKVVGNIVWVLTTSALLIALPLGLALEDEAKLVAQEKEMFEQQQGTQGMm 125 Schizophyllum commun...
XP_001875896  53 DIVPPTTRHSIASRVSKTASILKRGGKLVGNIVWVVTTSALLVALPLALTLEDEAKIVAQEKEMLEQQQGAQQML 127 Laccaria bicolor S23...
XP_001835684  53 DIVPPTTRHSIRSKISKTASVVKKTGKVFGNLVWVVTTSALLVALPLALALEDEAKIVAQEKEMLEQQQGAQLLA 127 Coprinopsis cinerea ...
CEL51786      57 DVVPPTTRQSIRSKVSNAASIAKRVGKIGGNVIWVITTSALLVGLPLALALEDEAKIVQQEKEMLAQQQGAQGML 131 Rhizoctonia solani A...
XP_007845660  52 DIVPPTTRHKISNRISSTAKFLKTTGKVVGNIVWVVTTSALLVGLPMALILEDEAKIVAQEQEMQEQQAGAQQML 126 Moniliophthora rorer...
CCU97428      68 DILSPSTRANIAKVWKTGSAYGFLGGWVAGKLIWVGVTSALLVGLPFALAVEDESRFAAQEKEIVAQQTGANTGA 142 Malassezia sympodial...
XP_001730341  67 DMLSPGLRAKISRTWQLTSAYGFFGGWVAGKLIWIGVTSALLVGLPFALAVEDESRFAVQEKEIAAQQQGSSSGA 141 Malassezia globosa C...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap