Conserved Protein Domain Family
IspA

?
pfam04279: IspA 
Intracellular septation protein A
Statistics
?
PSSM-Id: 398115
Aligned: 83 rows
Threshold Bit Score: 144.969
Threshold Setting Gi: 303299293
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A2SGN6                            1 MKFLFDLLPIVLFFVAFK----------------VAEgqpdaaaafasqhfgflvsggmvgpkeapVLLATLVVIVATFA 64  Methylibium petroleiphilum PM1...
dbos:1099484000100_PB2503_04087  18 AKLAVEMGPLIAFGIGYLahgrlagpvdaalntsFFVgeg------------------------reLYLAVLFSLPTFAA 73  Parvularcula bermudensis HTCC2503...
WP_012288850                     27 VRTAVDYGAPLAFAVAFFv---------------TKN-----------------------------FQTATWVLVAASAL 62  Caulobacter sp. K31...
Q9A288                            1 MRTVVDYGAAIAFGVAYFv---------------TKD-----------------------------FQKATWVLVAASAA 36  Caulobacter vibrioides CB15...
WP_012110308                     19 VRMAIELGPLVVFFLLNAqsdrf------fgneeAQN-----------------------------IFYATGGFMVATVI 63  Parvibaculum lavamentivorans...
jgi:Xaut_0207                    16 LKIGLEIGPLVLFFAANG----------------YGG-----------------------------IYVATGVFMVATLA 50  Xanthobacter autotrophicus Py2...
WP_012049133                     20 LKLAIDLGPLLVYLLAYWa---------------TRN-----------------------------IVLSTGIFMAATLA 55  Sphingomonas wittichii...
Q5NNH4                           20 VKMAIDYAPLVIFFLAYK----------------MTG-----------------------------FFIGTIAFMVSMIV 54  Zymomonas mobilis...
Q2G8I0                           13 VNLAVDYGPLLVFFLAYRyfkrdag---daglaeVVA-----------------------------VTKGTAAFMAATVV 60  Novosphingobium aromaticivorans DSM 12444...
Q1GPI4                           23 LNFAIDFGPLLVFFLAYKlssgge-----gafaaTTA-----------------------------AIKGTAAFMVAIVI 68  Sphingopyxis alaskensis...
A2SGN6                           65 QIGWLLLRGRKVDTMLWVSLGLVTVLGGATVWFHNETFIKWKPSVLYWVMGTAFWLSHAVfRKNLLQTLMGGQLQ-LPPA 143 Methylibium petroleiphilum PM1...
dbos:1099484000100_PB2503_04087  74 AFAYSVWKTKNIAPMLLISGVLVAVLGTLTFIFDSKTFVYMKPTIVYGMAAAVLAGGLVT-GRIFLKSLFDGALT-LPDP 151 Parvularcula bermudensis HTCC2503...
WP_012288850                     63 ALVLGYAVERRVALLPLFSGVMALIFGTLGLVFHSDVFVKIKVTVVNGALAIFMIGGVLM-GRAPLKALMGEAVH-LPDA 140 Caulobacter sp. K31...
Q9A288                           37 ALAIGYAVERRLAMLPLFFGGMALVFGTLGLIFGSDVFVKIKVTVINLALASFLVGGVLL-KRQPLKVIMGEALH-LPDA 114 Caulobacter vibrioides CB15...
WP_012110308                     64 SLGYSYARFRKVPTMPLVSGIFIIIFGALTLWLQDDEFIKLKPTIVNGIFATALLGAAVM-GKPIMKQLFDGAFN-LTDK 141 Parvibaculum lavamentivorans...
jgi:Xaut_0207                    51 ALLAMWVLARRIAVMPLVSALVVMVFGGLTLWLQDDHFIKLKPTMVNALFGVLLLGGLYF-KKPLLPYVFDGMVK-LTEE 128 Xanthobacter autotrophicus Py2...
WP_012049133                     56 AIVGSWITVRRVSAMLLFSGAMVLVFGGLTVWLHDATFIKMKPTVYYLMVAAILGFGLFT-DRPTLKLVLGQAYPgLSDL 134 Sphingomonas wittichii...
Q5NNH4                           55 AIGVSRYKLGRVSPTLWLSFVLIMFFGGLTLWFHDQRFIQLKPTIIYSFFAVMLLGGRLL-NKPMLKYIMEDAFDgVTEK 133 Zymomonas mobilis...
Q2G8I0                           61 ALIVSKLRLGRISPMLWLSTVLILGFGTLTVLLGDPFWIQVKPTAIYLLFSGVLFAGLAR-GKAMLRYLLEAAFDgLNEE 139 Novosphingobium aromaticivorans DSM 12444...
Q1GPI4                           69 AMAASKWKLGKISPMLWMSSILVLGFGALTIWFHDERFIVMKPTIIYGAFAAMLLGGWWF-KKPMLKYLLQSALEgLTEK 147 Sphingopyxis alaskensis...
A2SGN6                          144 VWRNLNFMWIAFFAFMGLANLYV--------AYsFPTD-----------VWVNFKLFGGVGLMLLFTLAQGLYLSRHIKT 204 Methylibium petroleiphilum PM1...
dbos:1099484000100_PB2503_04087 152 AWRTLTWRFVAFNAAAAAANEVLw-------RW-LTADcvagvecggeaTWVGIKIFGFTFAYFVFIALNVPFLMKHMPS 223 Parvularcula bermudensis HTCC2503...
WP_012288850                    141 AWRTLTLRYGAYFVVAAVANQIViaitngmpSV-QGND-----------LWVKFRI-ALLPLAVVFSLTQVPFMMKHMAK 207 Caulobacter sp. K31...
Q9A288                          115 AWRTLTLRYGAYFAFVAIINEVVr-------NT-QDTD-----------TWVKFRL-ALLPVALVFVATQLPFMMKHMAK 174 Caulobacter vibrioides CB15...
WP_012110308                    142 GWMVLTVRWGLFFVFLGIVNEVVw-------RN-FSTD-----------FWVSFKLFGVMPLTMVFGLAQISVLTKHAPA 202 Parvibaculum lavamentivorans...
jgi:Xaut_0207                   129 GWRVLTIRWGVFFLVMAVLNEIVw-------RS-VSTD-----------TWVAFKTFGYLPLTFAFAMAQAPLMARHELK 189 Xanthobacter autotrophicus Py2...
WP_012049133                    135 GWTKLTRNWALFFVAMAIANEAVw-------RS-TSME-----------FWLGYKLWGAMPATILFALANVPMLMKHGLT 195 Sphingomonas wittichii...
Q5NNH4                          134 GWLILSFNWGCFFLVMALLNEYL--------RThFSFD-----------VWLTLKIWGAMILSAVFGFANMPVLIKNGLN 194 Zymomonas mobilis...
Q2G8I0                          140 GWLKLSRNWAFFFLFLAGLNEVLryf--fnaAN-GNFE-----------IWLQAKLWGVTTLSFLFTFAQIPMLMKHGLA 205 Novosphingobium aromaticivorans DSM 12444...
Q1GPI4                          148 GWLLLSRNWGIFFAALGIANHGMyel--iqaKQ-MSFD-----------LWLTIKVWGVTALSFLFTLSQVPVMLKNGLA 213 Sphingopyxis alaskensis...
A2SGN6                          205 E 205 Methylibium petroleiphilum PM1
dbos:1099484000100_PB2503_04087 224 S 224 Parvularcula bermudensis HTCC2503
WP_012288850                    208 G 208 Caulobacter sp. K31
Q9A288                          175 G 175 Caulobacter vibrioides CB15
WP_012110308                    203 S 203 Parvibaculum lavamentivorans
jgi:Xaut_0207                   190 D 190 Xanthobacter autotrophicus Py2
WP_012049133                    196 T 196 Sphingomonas wittichii
Q5NNH4                          195 T 195 Zymomonas mobilis
Q2G8I0                          206 A 206 Novosphingobium aromaticivorans DSM 12444
Q1GPI4                          214 V 214 Sphingopyxis alaskensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap