Conserved Protein Domain Family
DUF434

?
pfam04256: DUF434 
Protein of unknown function (DUF434)
Statistics
?
PSSM-Id: 398097
Aligned: 49 rows
Threshold Bit Score: 58.6949
Threshold Setting Gi: 503022219
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Metev_0295  14 KLSEPAVDVRYLFNRGYPRTSTIQFVGNHYRLNEEERHILTRVVVSSNRSKLRKQ 68  Methanohalobium evestigatum Z-7303
CDG65498         7 TLKEAKKDFKYLLERGFPRSGALNYVGNHYLLGEMERNYLNRTVFPRAKIETRKE 61  Methanobacterium sp. MB1
jgi:Mfer_0750    3 KIDEAIKDLRYLLDRGYRKTIALKFVADHYLLSKKERNYLSRHVFSRRKIKERKS 57  Methanothermus fervidus DSM 2088
O27723           2 SLEMAAEDLRYLLNRGYRKRVALNFVANHYLLGREERNYLARCVFSDETVARRRS 56  Methanothermobacter thermautotrophicus...
Q58345           2 SIEKAKEDFKYLINRGYKKDVALNFVANHYKLSKEDRLKIIRTTHSDKEIKLTKR 56  Methanocaldococcus jannaschii DSM 2661
Q5JDK5           2 SLTDAYRDLRYLLNRGYPKKSALKFVADHYRLSLRDRYLLARCVFSDAWIAEVRR 56  Thermococcus kodakarensis KOD1
Q8U0C7           3 rVYEAYKDLKYLLNRGYRKSKALEFVCNHYLLPSNARHLLARCVFPTKWIEETKR 57  Pyrococcus furiosus
jgi:Msed_1639    7 QLREAILDYRYLLDRGYGSKPSLDLVTGRYGLNGEERLLLFRCIHPKKEVEMIKG 61  Metallosphaera sedula DSM 5348
WP_014025930    10 VLIEAMLDMYFLLSRGYPRRQSLEVVAARRGLNKWEKLAVYHCIHPYEVIQKVRR 64  Pyrolobus fumarii
jgi:Tpen_0220   19 FICEAAKDFFYLVNRGYSRKQSLELVTARYGLSKVEKLALYRSIFPREVAASRRK 73  Thermofilum pendens Hrk 5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap