5AF3


Conserved Protein Domain Family
DUF433

?
pfam04255: DUF433 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF433)
Statistics
?
PSSM-Id: 398096
Aligned: 285 rows
Threshold Bit Score: 38.5517
Threshold Setting Gi: 528525849
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5AF3_A           185 VVLDPRRGYGQPVFDGSGVRVADVLGPLRAGATFQAVADDY-GVTPDQLRDALD 237 Mycobacterium tuberculosis H37Rv
jgi:Halhy_3897    38 VEKTTGVCGGSACIVRTRIPVWLLVEALHSGASEAQLLLSYpSLRAEDLTNAWA 91  Haliscomenobacter hydrossis DSM 1100
Q6ZEG4            38 VEVHPLVCGGEPCIVRTRIPVWVLEQARRQGLNDGEILRCYpSLRAEDLVNAWA 91  Synechocystis sp. PCC 6803
Q8YVT2            36 IEKTAYVCGGDACITGTRIPVWVLINARRLGISEAQLLKDYpTLSATDLTNAWV 89  Nostoc sp. PCC 7120
WP_015177151      36 IEKTPDVCGGSACIAGTRITVWGLVEARRIGYSEAELLTSYrLLSATDIANAWA 89  Oscillatoria nigro-viridis
WP_015187163      36 IEKTPRVCGGEARISHTRIPVWVLVEARRLGYTDTELLTSYpSITATDLAHACA 89  Gloeocapsa sp. PCC 7428
WP_015115186      36 ITKTPGVCGGEACIAGTRIAIWLLVEAQQLGINEAQLLQDYpHITAADLVNAWA 89  Nostoc sp. PCC 7107
WP_015957232      36 ITKTPGVCGGAACIANTRIPVWVLVGYRRLKISDAELLKCYpTLTAIDLVNAWA 89  Gloeothece citriformis
jgi:Osc7112_0257  43 IQKTPGVMGTEACIRKTRIPVWLLVSYRRQSASDAHILEGHpDLSATDLVNAFS 96  Oscillatoria nigro-viridis PCC 7112
WP_015157705      36 VEKTPGICGGNARIVNTRITVWGLVNAKEIGYSDGDLLQSYpQLNAIDLVNAWN 89  Chamaesiphon minutus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap