Conserved Protein Domain Family
SirB

?
pfam04247: SirB 
Invasion gene expression up-regulator, SirB
SirB up-regulates Salmonella typhimurium invasion gene transcription. It is, however, not essential for the expression of these genes. Its function is unknown.
Statistics
?
PSSM-Id: 398090
Aligned: 92 rows
Threshold Bit Score: 61.8044
Threshold Setting Gi: 81393990
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Plav_1005     5 YAEIRLVHIWSVIASGSLFAMRGLALF-AgaggtGERLAMAA---PVRLLSYTIDTVLLTAALMLMTIvqqYPF--IDH- 77  Parvibaculum...
Q9K072            3 YLIVKYSHQIFVTITILVFNIRFFLLW-K-----NPEKPLAG---FWKALPHLNDTMLLFTGLWLMKIthfSPFnaP--- 70  Neisseria me...
Q3IK93            3 YLAVKHSHMAIAMLSVILFYVRSFSRM-G-----SGKLAKNK---LVFIGSHGIDTLLLVSALMLMGIakiNPFeqY--- 70  Pseudoaltero...
CCE25222          1 --MIKHIHMLFVALSIISFTGRIFLSE-T-----HSALLSQK---WLKIAPHVIDTVLLVSGISLVFIgg--wL--SADf 65  Methylomicro...
jgi:Metme_2854    1 --MLKHIHLLFVALVTFGFLGRVALAQ-Y-----RPEMLQQK---WIKLSPHILAGLLLLTGIGLVFQgn--wL--ANSy 65  Methylomonas...
WP_013817199      1 --MFKYVHILLVALVFISFTGRVLLAE-F-----NPMLLQKK---WLKFTPHFIDSLLLLTGIALLIQgr--wL--HADh 65  Methylomonas...
Q21KQ5            2 FAVIKHIHVWLVLLSIGGFAVRFLWLM-G-----NSSKLQLR---AVKIAPHVIDTLLLVTGVTLAVMlrySPFdyS--- 69  Saccharophag...
tigr:TERTU_2612   4 iLVAKHLHVWFALLTFVGFSLRFLWLI-G-----RSDLLHKR---WVKILPHINDTGLLISGVTLAIFfgySPF--AVF- 71  Teredinibact...
WP_014244857      4 YEVYKVIHLLCILLTVAGLAVGYYSTQpK----------------HIKIISGITSLLILVSGMGLLARlgvSHGegFPG- 66  Halobacterio...
WP_015465320      2 YAFLKHTHLTLILIAVIFFIVNFIWLQ-R-----GHKNAQKAifkKILLHTHLT---VLAFGLILAWLlqiDPFvsSGY- 71  Psychromonas...
jgi:Plav_1005    78 -WLTVKVVLLVVYIALGMMAFRFGRTRGQRI-GAFAAALAVFLYIVSVALAHDP 129 Parvibaculum lavamentivorans DS-1
Q9K072           71 -WLGTKILLLLAYIALGMMMM-RARPRSTKFyTVYLLAMCCVACIVYLAKTKVl 122 Neisseria meningitidis serogroup B
Q3IK93           71 -WLLEKIVLVVIYIAVGIVSS-KQTKTAPKV-AYTIFNTLVILAIGYLATAKSA 121 Pseudoalteromonas haloplanktis TAC125
CCE25222         66 gWIIAKIVALLGYIGLGIVAMRSHGNQR--W-LAFAGALLCFIYIALVAVNKQA 116 Methylomicrobium alcaliphilum 20Z
jgi:Metme_2854   66 gWIVAKLILMFVFIGLGLMTMREQGQKR--W-IAFGAALFCLFYIVKVAFTKQA 116 Methylomonas methanica MC09
WP_013817199     66 dWLIAKGLILIAYIGLGMLSMRKHGLQR--W-LAASGALVCLVFMVEIAVNKTI 116 Methylomonas methanica
Q21KQ5           70 -WFSIKLLLVITYIGLGITAF-KIPHKHLRA-IFGISALLTACAIIILATSKpf 120 Saccharophagus degradans 2-40
tigr:TERTU_2612  72 -WFGVKLALIALYIVLGVLLFRTHQNRLYQI-TLFSMSFITYFFIIIVVLTKpn 123 Teredinibacter turnerae T7901
WP_014244857     67 -WVMVKMMIWLIIAVAGPVLA-KRLSSSLKP-KAFWGLILLFFIAIYFAVNKSf 117 Halobacteriovorax marinus
WP_015465320     72 -WLLEKLIAFVAYLFMVNRALNAQKSRPIQW-LSFVGAFGWLAYIVYLVTMKQA 123 Psychromonas sp. CNPT3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap