Conserved Protein Domain Family
DUF413

?
pfam04219: DUF413 
Protein of unknown function, DUF
Statistics
?
PSSM-Id: 398067
Aligned: 27 rows
Threshold Bit Score: 132.743
Threshold Setting Gi: 81362535
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
chanu:ambt_06005  18 FIDRQKFPYGFRKSGDFSIGEADILTSYGKTLLALECGELTPESDDERHFVDFISGKVDADNTIERTWAKYVRLSRGKKH 97  Alteromonas...
CAV27582          13 FYDTIKFPRGFAKSGDFTLSEEEILTLFGDTMFALETGELSPSNSEEKHFIKVLSHPHKAKSKLERVWLKYIQLARGRRR 92  Vibrio tasm...
Q3IG65            18 FFDDQNFPRGFGRSGNFTLLEASILEQHGVVLKGLHNKALEPQNEHQQQFVAVISGALEPTNAIERAWVKYLKLTTSKAK 97  Pseudoalter...
SDU:GNIT_2969     14 FSDPKHYPYGFSRSGDFSIAESKALSQYGCLIAALVDGHLAPSNEEEAAFIDSALGRKQPETTAERAWLKYQNRINRPK- 92  Glaciecola ...
Q15Y86            14 FSDPKNYPYGFSRSGDFSISESKALSQYGCLIAALLDGRIEPECDEDNSLLAVAKGEKDPSNVAEKAWSKYDKRIHRPK- 92  Pseudoalter...
chanu:ambt_15935  14 FADKKHYPYGFARSGDFSISESKLLQAHGSLFAALVDGKIEPSSDVEINYLNAALGQCEPQTPQAKAWIKYQNRINRPK- 92  Alteromonas...
CCU72859          15 FFDDLNFPRGFQRAGDFTRNQAQILESMGVALKALHEGTREPVTDEEERFVSMCKQEIEPQSEVERTWSTYMKALARKQI 94  Thalassolit...
WP_011760111      28 FYDDANFPKGFRRSGDFTNKEAELLECHGLAMKALADGSRLPSTDEEAQFVDVVRGNKSASSILEQIWLKYCKLAQGKP- 106 Shewanella ...
Q8EF04            29 FYDDTNFPKGFKRSGDFTSKEAELLELHGHAMKNLAEGKTLPVTADEAQFVEVIKGNIAPSSLLEHIWLKYRKLARGKP- 107 Shewanella ...
Q12LT6            29 FYDDANFPKGFKRCGDFTSKEAELLELHGHAMKNLVEGKQLACTPDEDQFIQAAQGNITPTTQFELLWAKYVKLAKGKP- 107 Shewanella ...
chanu:ambt_06005  98 FYTLHSTAA 106 Alteromonas naphthalenivorans
CAV27582          93 FHTLNGCKR 101 Vibrio tasmaniensis LGP32
Q3IG65            98 FHTLFGRSK 106 Pseudoalteromonas haloplanktis TAC125
SDU:GNIT_2969     93 YASIHGTKK 101 Glaciecola nitratireducens FR1064
Q15Y86            93 LGNIYGSRP 101 Pseudoalteromonas atlantica T6c
chanu:ambt_15935  93 AASIYGSKR 101 Alteromonas naphthalenivorans
CCU72859          95 YFTAssaav 103 Thalassolituus oleivorans MIL-1
WP_011760111     107 FYAVVGTVH 115 Shewanella amazonensis
Q8EF04           108 FYAVVGTVH 116 Shewanella oneidensis
Q12LT6           108 FYAVVGTVH 116 Shewanella denitrificans OS217
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap