1BW6,2ELH


Conserved Protein Domain Family
CENP-B_N

?
pfam04218: CENP-B_N 
Click on image for an interactive view with Cn3D
CENP-B N-terminal DNA-binding domain
Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere. Within the N-terminal 125 residues, there is a DNA-binding region, which binds to a corresponding 17bp CENP-B box sequence. CENP-B dimers either bind two separate DNA molecules or alternatively, they may bind two CENP-B boxes on one DNA molecule, with the intervening stretch of DNA forming a loop structure. The CENP-B DNA-binding domain consists of two repeating domains, RP1 and RP2. This family corresponds to RP1 has been shown to consist of four helices in a helix-turn-helix structure.
Statistics
?
PSSM-Id: 398066
Aligned: 6 rows
Threshold Bit Score: 67.0975
Threshold Setting Gi: 194201930
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1BW6_A         2 GPKRRQLTFREKSRIIQEVEENPdlRKGEIARRFNIPPSTLSTILKNKRAILASE 56  human
Q9VP44        27 RNERNILTFYEKIAVIRYYDETNi-SRNSLAKMFHCCATQIRRILDKKKDLLQQL 80  fruit fly
EDX15506       7 RKPRTSLTLEEKMEVIQSQEQNKl-SVRDLAKRFNIGKTQAADILKHKQSIKEGl 60  Drosophila simulans
Q60976        14 KRKRVVLTLKEKIDICTRLERGE--SRKALMQEYNVGMSTLYDIKAHKAQLLRFF 66  house mouse
XP_004092099   9 RKSRTSLTLNQKLEMIKLSEEGM--SKAEIGRRLGLLRQTVSQVVNAKEKFLKEV 61  northern white-cheeked gibbon
2ELH_A        17 KRPLRSLTPRDKIHAIQRIHDGE--SKASVARDIGVPESTLRGWCKNEDKLRFMS 69  fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap