Conserved Protein Domain Family
MtrC

?
pfam04211: MtrC 
Tetrahydromethanopterin S-methyltransferase, subunit C
The N5-methyltetrahydromethanopterin: coenzyme M (EC:2.1.1.86) of Methanosarcina mazei Go1 is a membrane-associated, corrinoid-containing protein that uses a transmethylation reaction to drive an energy-conserving sodium ion pump.
Statistics
?
PSSM-Id: 398060
Aligned: 21 rows
Threshold Bit Score: 255.274
Threshold Setting Gi: 121707808
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013718863     2 SVGGSAGGAPSAYEPKKLRMYGLVGSIVGIYLGSILnsalNTEvFSFIGAVAAIFAVVMGANSVRRVCAYGIGTGVPSIG 81  Methanothrix ...
Q58259           2 SHGGGGHAAE-LYPEEQIFAVGIALSLVGCYLANFLspy---glGMLIGGLLASAACVAGANTVRKVAAYGLGTGVPSIG 77  Methanocaldoc...
jgi:Maeo_1271    2 SHGGGGHAAE-RYPEGQVLLAGSVLAIIGMYIAHFAtqfgYGQlSMLVGGLLAVAATVAGANTTRKVAAYGLGTGVPSIG 80  Methanococcus...
Q6LWZ2           2 SHGGGGHAAE-LFPEDQVLAIGAVLSIIGMYVAQFV-----PSlAMLIGGLLAAGACVAGANTTRRVAAYGLGTGVPSIG 75  Methanococcus...
WP_013180516     2 SHGGGGHAAE-LFPETQVLGIGLVLALIGMYIANFL-----PEyAMLIGGALTVPACVAGANTTRKVAAYGLGTGVPSIG 75  Methanococcus...
WP_013413858     8 ghgAPTKVAEVEIPPIRLIAFGTIGGLIGIYLSGI------PVvGPVIAGLGGVCAIFWGADAVRRVASYGLGTGVPSIG 81  Methanothermu...
WP_023992798     2 SVAGGG-GGESSVNPKMTAGIGIIGGFLGIYLTPI-----NPViGPLLAALGAVCAIIWGADAIARVASYGLGTGVPSIG 75  Methanobacter...
O27229           2 SVAAGG-PAGAAIPESRLMALGIIGGLGGIYASTV-----NPViGPVFASLGAVCAIIWGADAIRRVASYGLGTGVPSIG 75  Methanothermo...
WP_016359089     1 -----madEGQAVSSTNLLILGVIGGLILVYLSTV-----NATiGPLFACLGGVCAILWGSDAIRRVASYGLGTGVPSIG 70  Methanobrevib...
agres:mru_1921   2 SAGGSGAPAEGAVNANVMLAVGIIGGLIGIYASSF-----EPTiGPVIACLGAVCAILWGVLAIRSVASYGLGTGVPSIG 76  Methanobrevib...
WP_013718863    82 MLALGMGIIAVMFGLSVAEtlg--------fgMLGPIITLIYAGVFGYIIGVIANKVIKFNIPVMEEGNADLSMAGALAI 153 Methanothrix ...
Q58259          78 MVSLGMGTLAAVAGVLIPDyfn-------lpyLVAPIITLIVSAVIGYIVGRLTVNPVGMKIPIMVRSMTFLSIAGAMAL 150 Methanocaldoc...
jgi:Maeo_1271   81 MAALGMGTIATLAGILIPSvlisqfafpneiiYAIPILISIVALILGVVVGKLTVNPIGMKVPIMVQSMTYLSLMGALSV 160 Methanococcus...
Q6LWZ2          76 MVSLGMGTISALAGVLIPSafg-------lpvLATPILAAVIAVVVGFIVGKLTQNPVGMKVPIIVSSMTKLSLMGALAI 148 Methanococcus...
WP_013180516    76 MVSLGMGTISALAAVYLPValg-------idsMATPIIAVIVSLLIGAIVGKLTQNPVGMKVPIIVSSMIKLSLMGALSI 148 Methanococcus...
WP_013413858    82 AMLGAVGLLSTIMGVSVPLlska------ipsLLAPIAALIIALIIGAVSGIVGRVFIKMEIPIFVQCTTELAGASVLSV 155 Methanothermu...
WP_023992798    76 YMSLAVGVIGTMAGLAGGImlpt------tytILAPALGVALSVILGGVIAVIAKKVIKMKIPVLVTGTMELTAAAALSV 149 Methanobacter...
O27229          76 YMSVSIGIVGVVAGLASVFtl---------paLAAPVVGLILAMILGVVVAVLGKKIVKMKIPILEKCTAEISGAAALSV 146 Methanothermo...
WP_016359089    71 YMSLGAGCVAALTGLAVGAqfn--------lvIAGPVLALVFGCIIGLIIAVVAKKIVGMKIPVLERCTTELAGAAALSV 142 Methanobrevib...
agres:mru_1921  77 YMSLGIGVIGALAGVGIIAafkl-----kgleMLGPILALVFAMLIGLLVAIVAKKIVGMKIPVMERCTAEIAGAAALAV 151 Methanobrevib...
WP_013718863   154 LGWSFAISGTLGY--DDIVNDVLMTGYIAIIFIAGGLAILHPFNANLGPDEKQDRTLVNAIMVGGLAMTATGIGALLTQG 231 Methanothrix ...
Q58259         151 LGFTVAYVGSLEP--QKYIDYALNNGMMALAFIAAGMAILHPFNACLGPNESHKRTLTLAVACGFITWFVFSVVKLD--- 225 Methanocaldoc...
jgi:Maeo_1271  161 SGFCIAFAGGFTP--DVFMAGAVKTGIIGLAFIAAGMAILHPFNACLGPNEDHGRTLKLALACGLITWFMFAVAKLD--- 235 Methanococcus...
Q6LWZ2         149 LGFCTAFAGGFSA--DLIINGAINNGVIALAFIAAGMSILHPFNACIGPDESHKRTITLAVACGLMAWLIFSIAKLD--- 223 Methanococcus...
WP_013180516   149 LGFCTAFAGGFSA--KVFIPGAIETGMIGLAFIAAGIAILHPFNACLGPNESHRRTMYLAIACGLLAWLVFAISKLD--- 223 Methanococcus...
WP_013413858   156 LAFSSAIAGSYLMtgSGLLNPTLLTGYMPALYFMCAMAIQHPFNACLGPNEDQYRTLKCALAAGFAMMAIVGILSIIKNP 235 Methanothermu...
WP_023992798   150 IGFSAAIAGSYAM--APILKSVVTTGFIGLLFIMNTMAIQHPFNACLGPQEDRARTLKLAGSAGFIAMAIVGLLGMSTTK 227 Methanobacter...
O27229         147 LGFSAAIAGSYTM--QAVLTSVIATGFIGLLFILNTMAIQHPFNACLGPNENQTRTLKLAASTGFISMAIAGLLGIGLNP 224 Methanothermo...
WP_016359089   143 VAFSAAIAGSIDF--TPILNNVVATGFIALLFILNTMAIQHPYNACLGPNEDQVRTLKCAASTAFLSMIIVGICTIPLGH 220 Methanobrevib...
agres:mru_1921 152 LGFSSAIAGGYSI--DLLLTAVVAPGFIALFYILVTMAIQHPFNACLGPNEDQVRTLKCGASTAFLTMIITGILAISAGG 229 Methanobrevib...
WP_013718863   232 LGAgLLQIIIGFAIWYYFFKMYYKLVKRDASAVVGTGLLP 271 Methanothrix soehngenii
Q58259         226 ----IVSIIVSIILWAIVYVKFVKMSFKDACAVLHVPEIP 261 Methanocaldococcus jannaschii DSM 2661
jgi:Maeo_1271  236 ----VISSIVSLILWALVYVSFVKQSLNDACDVLYTPELP 271 Methanococcus aeolicus Nankai-3
Q6LWZ2         224 ----IVSIVVAAIFWLYTYGSFVKMSLGDACEVKYVPELP 259 Methanococcus maripaludis S2
WP_013180516   224 ----AISVVISAVLWVATYAMFVKMSLNDASDVLYTPELP 259 Methanococcus voltae
WP_013413858   236 -YW-WLISLVAAVGWAISMKMFVKDVFENTI-VQRTGWWP 272 Methanothermus fervidus
WP_023992798   228 -AW-WVIAIIGALAWFISFRMFLQASKEDAASVAWSGMWP 265 Methanobacterium sp. MB1
O27229         225 -GW-WLVSLVGALCWVVAFKSFVSASFEEAASVKWSGLWP 262 Methanothermobacter thermautotrophicus str. Delta H
WP_016359089   221 SAW-LLVVVVGLIGWIIAFRSFVQASYEAAASVKWSGLWP 259 Methanobrevibacter
agres:mru_1921 230 YAW-FAILVVGLIGWYVSFKMFVNASYEAAASVKWSGLWP 268 Methanobrevibacter ruminantium M1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap