1EYB


Conserved Protein Domain Family
HgmA

?
pfam04209: HgmA 
Click on image for an interactive view with Cn3D
homogentisate 1,2-dioxygenase
Homogentisate dioxygenase cleaves the aromatic ring during the metabolic degradation of Phe and Tyr. Homogentisate dioxygenase deficiency causes alkaptonuria. The structure of homogentisate dioxygenase shows that the enzyme forms a hexamer arrangement comprised of a dimer of trimers. The active site iron ion is coordinated near the interface between the trimers.
Statistics
?
PSSM-Id: 398059
Aligned: 11 rows
Threshold Bit Score: 780.771
Threshold Setting Gi: 10720010
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1EYB_A        31 KYISGFGNECSSedPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESID--EGHVT 108 human
Q9A5B8         4 RYQTGFGSYFET--EAHPGALPVGRNSPQKVPFGLYAEQLSGSAFTAPRHENRRTWLYRLRPSAGHEAYQPYA--QDKLV 79  Caulobacter vib...
Q9X4G0         9 AYQSGFGNEFSS--EALPGALPVGQNSPQKAPYGLYAELLSGTAFTMARSEARRTWLYRITPSAKHPPFRRLE--RQIAG 84  Pseudomonas aer...
Q9S2B5        13 AYLSGFGNEHAS--EAVAGALPEGRNSPQRAPLGLYAEQLSGTAFTEPRAHNRRSWLYRIRPSAAHP-AFTRSgnGTIRT 89  Streptomyces co...
Q9X4F5        20 GYMPGFGNDFET--ESLPGALPQGQNSPQKCNYGLYAEQLSGSPFTAPRGTNERSWLYRIRPSVRHTGRFRRVdyPHWKT 97  Sinorhizobium m...
Q9S4T0         1 MYLQGFGNYHHS--EAVKGALPPNQNSPQHCSLGLYAEQLSGTAFTRPRHNNLRSWLYRILPTVTQGTYYPYE---FNIM 75  Legionella pneu...
Q00667        13 TYQNGFDSYHES--EAIEGALPVGHNSPQKAPYGLYAEKLSGTAFTAPRHENKQTWVYRILPAAAHENFVEEDasSYHTL 90  Aspergillus nid...
Q54QI4         9 EYQSGFGNSFES--EAIKGTLPKGRNAPQNCPLDLYAEQLSGNAFTAPRHTQQRSWLYRIRPSVCHTPLKPID---SGLV 83  Dictyostelium d...
Q9Y041         8 KYLTGFGNEHATsdPRVPDALPVGQNSPQKCSHGLYAEQLSGTAFTAPRSQNQRSWLYRIRPSVIHRPFEAMKenDQHWT 87  Caenorhabditis ...
Q9VKJ0         5 KYLSGFGSHFSSedERYPNSLPVGQNSPQVCPYKLYAEQLSGSAFTAPRTENMRTWLYRKLPSAAHLPFQPFKg-aEYFS 83  fruit fly
NP_001304278  15 EYQTGFGNHFSS--EAIVGALPQGQNSPLICPFGLYAEQISGTSFTSPRKLNQRSWLYRIKPSVTHEPFRPRMprHEKLV 92  tomato
1EYB_A       109 HNWDEVDPd--PNQLRWKPFEIPkasQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSXENRCFYNSDGDFLIVPQK 186 human
Q9A5B8        80 SAFPGPAT---PNRLRWSPLEIP---AAPTDFVDGLVSLAGNADAATLGGIAAHVYLVNVSMKNRVFYNADGEMLIVPQM 153 Caulobacter vib...
Q9X4G0        85 AELD--APt--PNRLRWDPLALP---EQPTDFLDGLLRMAANAPGDKPAGVSIYQYLANRSM-ERCFYDADGELLLVPQL 156 Pseudomonas aer...
Q9S2B5        90 APFN-QAVp-dPNRLRWNPLPVPg---PATDFVEGLWTLGGNGDATQRTGMAVHLYHATASM-DRVFSDADGELLIVPER 163 Streptomyces co...
Q9X4F5        98 APHVGEHSl-aLGQLRWSPLPAPs---EALDFLQGIRTMTTAGDALTQAGMAAHAYAFNADMVDDYFFNADGELLIVPET 173 Sinorhizobium m...
Q9S4T0        76 QPFVDELS---PNAMRWSPLYNSs--QIKCDFVEGLFHIAGS--PLVNT----YTYYCNHSMSDKYFANNDGELLFVPYA 144 Legionella pneu...
Q00667        91 SDAKKLQHi--PNQLRWDPFDL----DETVDWVHGLHLVAGSGDPTVKQGLGILLYAAGKDMGKEAFYSADGDFLIVAQH 164 Aspergillus nid...
Q54QI4        84 CDLNNLHVd--PNQLRWKPFPITe--DKPHDFVEGLITIAGAGHASVRHGLAIHIYTATKSMENKSFYNSDGDFLIVPQQ 159 Dictyostelium d...
Q9Y041        88 NNFSSIPPn--PNQYRWNPFPLPt--KEGVTFVDNLYTVCGGGDVISRTGLAIHQFSCNASMEHTAMYNSDGDFLIVPQQ 163 Caenorhabditis ...
Q9VKJ0        84 QNWDEQPPn--PNQLRWKPFDLPpkdGKNVNFVEGLHTVCGAGDPRSRHGLAIHIYSCNGSMDNSAFYNSDGDFLIVPQQ 161 fruit fly
NP_001304278  93 SEFNQSNSsatPTQLRWKPVEIP---ETPTDFIDGLYTICGAGSSYLRHGFAIHMYTANKSMENSAFCNADGDFLIVPQK 169 tomato
1EYB_A       187 GNLLIYTEFGKXLVQPNEICVIQRGXRFSIDVF-EE--TRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDR 263 human
Q9A5B8       154 GELTLVTEMGVLKAGPGHIAVIPRGVRFRVEVE-GP--ARGYVCENYGAAFRLPELGPIGANGLANPRDFEAPVAAFEDI 230 Caulobacter vib...
Q9X4G0       157 GRLRLCTELGALQVEPLEIAVIPRGMKFRVELLdGE--ARGYIAENHGAPLRLPDLGPIGSNGLANPRDFLTPVARYEDS 234 Pseudomonas aer...
Q9S2B5       164 GGLLLRTEFGLLHAEPGHVALIPRGVRFRVQLLdED--ARGYVCENYGAPFQLPDLGPIGANGLANARDFRAPVAAYEDD 241 Streptomyces co...
Q9X4F5       174 GAIQVFTELGRMDVEPSEICLIPRGMMFKVTRLgEEkvWRGYICENYGAKFTLPDRGPIGANCLANPRDFKTPVAAYEDK 253 Sinorhizobium m...
Q9S4T0       145 GEIHLHTEFGKLMLSSGSIAVIPRGVKFKVEVIsKE--AKGYLCENSGNPLTLPQLGPIGANGLANPRHFQYPVAAFENS 222 Legionella pneu...
Q00667       165 GVLDIQTELGRLLVRPNEICVIPRGVRYRVTLPdGP--VRGYICELYQGHYQLPELGPIGSNGLANARDFQAPVAAFDDE 242 Aspergillus nid...
Q54QI4       160 GTLDIQTEFGFMKVKSGEICVIQRGITFSVNVE-GP--TRGYICEVFGSHFKLPDLGPIGANGLANPRDFLSPVAAYEKK 236 Dictyostelium d...
Q9Y041       164 GALEITTEFGRLLVNPQEIAVIPQGIRFSVAVR-GP--SRGYILEVYGTHFQLPDLGPIGANGLANPRDFEAPVAWFEDL 240 Caenorhabditis ...
Q9VKJ0       162 GVLDITTEFGRMSVAPNEICVIPQGIRFAVNVD-SP--SRGYILEVYDDHFVLPDLGPIGANGLANPRDFETPVAWFDDR 238 fruit fly
NP_001304278 170 GRLWITTECGRLQVCPGEIVILPQGYRFAVDLPdGP--SRGYVAETFGTHLQLPDLGPIGANGLAAPRDFLVPVAWYGDG 247 tomato
1EYB_A       264 QVp-gGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFXVINSVAFDHADPSIFTVLTAKSVRPGVAIADFV 342 human
Q9A5B8       231 DT---PTQVIQKFQGALWAATWDHSPLDVVAWHGNLTPYRYDLSRFNTINTVSYDHPDPSIFTVLTSPSDTPGTANCDFV 307 Caulobacter vib...
Q9X4G0       235 RQ---PLQLVQKYLGELWACELDHSPLDVVAWHGNNVPYKYDLRRFNTIGTVSFDHPDPSIFTVLTSPTSVPGLANIDFV 311 Pseudomonas aer...
Q9S2B5       242 EStpgPVEVVNKFCGNLWTAEYDHSPLDVVAWHGNHVPYVYDLRRFNVIGSISYDHPDPSIFTVLTSPSDTPGLAGVDFV 321 Streptomyces co...
Q9X4F5       254 ET---PCRVQVKWCGSFHMVEIGHSPLDVVAWHGNYAPYKYDLKTFSPVGAILFDHPDPSIFTVLTAPSGEEGTANVDFV 330 Sinorhizobium m...
Q9S4T0       223 GS---EHTIICKNQKKLWFTVCNHSPLNVVAWHGNYAPYCYDLSLFNTINTVSFDHPDPSIFTVLTSESEIPGVSNLDFV 299 Legionella pneu...
Q00667       243 EGp-tEYRLYSKFNNHLFSARQDHTPFDIVAWHGNYYPYKYDLGRFNTMGSVSFDHPDPSIYTVLTGPSDHVGTAIADFV 321 Aspergillus nid...
Q54QI4       237 EGi--EHTKINKFLGKLFSATQTYSPFNVVAWHGNYCPYKYDLSLFCVVNSVSFDHLDPSIFTVLTAPTNEVGVAAADFV 314 Dictyostelium d...
Q9Y041       241 DV---EFTIINKYQGSWFQAKQGHSPFDVVGWHGNYVPYKYDLKKFMVINTVSFDHCDPSIFTVLTAPSVKHGTAIADFV 317 Caenorhabditis ...
Q9VKJ0       239 DVk--DFQVISKFQGRLFVAKQNHTVFDVVAWHGNYVPFKYDLSKFMVINSVSFDHCDPSIFTVLTCPSLRAGTAIADFV 316 fruit fly
NP_001304278 248 SRp--GYTIVQKYGGELFTAKQDFSPFNVVAWHGNYVPYKYDLSKFCPYNTVLMDHSDPSINTVLTAPTDKPGVALLDFV 325 tomato
1EYB_A       343 IFPPRWGVADKTFRPPYYHRNCXSEFXGLIRGHYEAKQGG-FLPGGGSLHSTXTPHGPDADCFEK--ASKVKLAPERIAD 419 human
Q9A5B8       308 IFPPRWMVAEDTFRPPWFHRNVMSEFMGLIHGAYDAKAGG-FVPGGASLHNCMSDHGPDVASHKK--ATEVVLAPHKIDG 384 Caulobacter vib...
Q9X4G0       312 IFPPRWMVAENTFRPPWFHRNLMNEFMGLIQGAYDAKAGG-FVPGGASLHSCMSAHGPDAESCDK--AIAADLKPHRIDQ 388 Pseudomonas aer...
Q9S2B5       322 VFAPRWLVGEDTFRPPYFHRNVMSEYMGLIEGAYDAKAEG-FVPGGGSLHNMMSAHGPDRETFDR--ASAAELKPQRIDD 398 Streptomyces co...
Q9X4F5       331 IFPPRWLVAEHTFRPPWYHRNIMSEFMGLIYGRYDAKEEG-FVPGGMSLHNMMLAHGPDFSGFEK--ASNGELKPVKLDN 407 Sinorhizobium m...
Q9S4T0       300 IFPPRWMVAEHTFRPPYFHRNYMNELMGLVYGEYDAKKEG-FIPGGISIHNCMTPHGPDYESYEI--AASQDLKPNYINS 376 Legionella pneu...
Q00667       322 IFPPRWLVAEKTFRPPWYHRNTMSEFMGLITGNYDAKTGGgFQPAGASLHNIMSAHGPDMHAFEG--ASNADLKPTKIGD 399 Aspergillus nid...
Q54QI4       315 IFPPRWLVQENTFRPPYFHRNCMSEFMGLIRGVYEAKKEG-FLPGGGSLHSCMTPHGPDSDTFYA--AIKAELKPTKIPD 391 Dictyostelium d...
Q9Y041       318 IFPPRWGCADNTFRPPYYHRNCMSEYMGLITGCYEAKEGG-FKPGGGSLHSMMTPHGPDFNCFEM--ASNADLKPQRVAE 394 Caenorhabditis ...
Q9VKJ0       317 IFPPRWSVQEHTFRPPYYHRNCMSEFMGLILGKYEAKEDG-FAAGGATLHSMMTPHGPDVKCFEG--ASNAKLVPERVAE 393 fruit fly
NP_001304278 326 IFPPRWLVAEHTFRPPYYHRNCMSEFMGLIYGGYEAKADG-FHPGGASLHSCMTPHGPDTKTFEAtiALGNEAGPHRIAD 404 tomato
1EYB_A       420 gTXAFXFESSLSLAVTKWGlKASRCLDENYHKC-WEPLKSHF 460 human
Q9A5B8       385 -TMAFMFESRWVFRPTHLA-LESAALQSDYDAC-WTGFPKAR 423 Caulobacter vibrioides CB15
Q9X4G0       389 -TMAFMFETSQVLRPSRAA-LETPALQNDYDAC-WASLVSTF 427 Pseudomonas aeruginosa PAO1
Q9S2B5       399 -GLAFMFETRWPVTLTPQA-ARAEHLQPGYDDV-WQGLERHF 437 Streptomyces coelicolor A3(2)
Q9X4F5       408 -TMAFMFETRFPQQLTTFA-AELDTLQDDYMDC-WSGLERKF 446 Sinorhizobium meliloti 1021
Q9S4T0       377 --LAFMFETKDYWQVTEQA-YRHPSRQMDYLNC-WQGFKIEF 414 Legionella pneumophila subsp. pneumophila str. Philad...
Q00667       400 gSMAFMFESSLMVGVSEWGlKTCQKVQEEYNEHsWQPLKRHF 441 Aspergillus nidulans FGSC A4
Q54QI4       392 vALAFMFESSLILGISDYA--KKNFIDDDYWKC-WQGLKDNS 430 Dictyostelium discoideum
Q9Y041       395 gTMSFMFESSLNMAITNWA--VYQNVDKDYYKD-WQPLKKHF 433 Caenorhabditis elegans
Q9VKJ0       394 gTQAFMFESSLSLAVTKWGeETCQKLDAAYYEC-WQALKNNF 434 fruit fly
NP_001304278 405 -TMAFMFESCLVPRVCPWA-LESPFMDHDYYQC-WIGLKSHF 443 tomato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap