5L8X


Conserved Protein Domain Family
MtrA

?
pfam04208: MtrA 
Click on image for an interactive view with Cn3D
Tetrahydromethanopterin S-methyltransferase, subunit A
The N5-methyltetrahydromethanopterin: coenzyme M (EC:2.1.1.86) of Methanosarcina mazei Go1 is a membrane-associated, corrinoid-containing protein that uses a transmethylation reaction to drive an energy-conserving sodium ion pump.
Statistics
?
PSSM-Id: 398058
Aligned: 26 rows
Threshold Bit Score: 271.086
Threshold Setting Gi: 317411856
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5L8X_A             6 KREPAPGWPIVSGEYVVGNPESCVGVVTLGSHGLEQACIDAG---AAIAGPCHTENLGIEKVVANYISNPNIRFMILCGS 82  Methanocald...
WP_004079630       4 KRAPASGWPKIQGDYHAGNAESPVAVVTVGSHLDEQGICDAG---AAICGSCKTENLGLEKIVANVVANPNIRFMVTCGT 80  Methanoplan...
WP_011833921       4 KKSPANGWPIIQGDYHTGDANSPVAVITMGSHLDEAGICAAG---AALAGSCKTENLGIEKVVANVISNPNIRFVLLCGT 80  Methanocorp...
Q2FRN2             4 KKSPASGWPIVQGDFHTGDPNSPVAVVTMGSHLDEGAICSAG---AAIAGSCKTENLGLEKVIANVISNPNIRFVITCGT 80  Methanospir...
A6UWH7             4 KKAPASGWPIVSGEYVVGNPESCVAVVTLGSHGLDEAAIEAG---AAISGPCHTENLGIEKVVANYISNPNIRFMLVTGS 80  Methanococc...
O32867             4 KAEPAEGWPVVEGDYVVGDPEAPVHVVTLGSHIEEDILKAAGedkVAIAGPCKTENIGIEKVIANVIANPNIRFGVLCGA 83  Methanopyru...
O27227             4 KKSPAEGWPVVNGDYIVGDPESPVAATTLASHIEDVPV-EAG---AAIAGPCKTENLGIEKMIANLISNPNIRFLILCGS 79  Methanother...
D3E045             4 KKPAADNWPVVSGDYIVGDPESPVAVTTLASHNEDIPA-AAG---AAIAGPCKTENLGIEKVVANIISNPNIRFLILCGA 79  Methanobrev...
NZAGRC:Abm4_1521   4 KKSPADGWPLISGEYEVGDPESPVAATTLASELAGDIV-GAG---AAIAGTCHTENLGVEKVVANTISNPNIRFLIVCGA 79  Methanobrev...
Q2NI29             4 KKEVIQNWPLETGDYAVGNVESPVAVVSLGSNMNDELV-AAG---AAISGPLHTENLGIEKVVANIISNSNIRYVLICGS 79  Methanospha...
5L8X_A            83 EVQGHITGQCFKALWENGIgDDGG-IIGAKGAIPFLENVNKEAVERFRRQIvEVVDLIDCEDIGKITQAIKECLSKDPGA 161 Methanocald...
WP_004079630      81 EVKGHLSGQCLHALHANGL-EGGK-IVGAKGAIPFIENLTDESIQRFRDQI-EMVDIMESEDMGAIKAKIDELTARDPGA 157 Methanoplan...
WP_011833921      81 EVKGHLSGQSIEAMHKNGV-EGGK-IVGSTGAIPFLENLTAEHIKRFQEQI-ELVNIMETEDMGQISAKINELKGRDPGA 157 Methanocorp...
Q2FRN2            81 EVKGHLSGQSLIALHQNGV-DGGK-IVGSKGAIPFIENLSADNIKRFQEQV-ELVDIMESEDLGAISAKIKELTARDPGA 157 Methanospir...
A6UWH7            81 EVQGHITGQCFKALYENGIgDDGG-IIGAKGAIPFLENAGQDAISRFQNQLvEIVDLIDVEDTGKISSAIKDCISKDPGA 159 Methanococc...
O32867            84 EVTGHLTGQCFKAMYENGVdPDSGeIIGAEGAIPYLENIPEEAVERYRDQIvELVDLIDVEDVDEIVKAIEECVEKDPGA 163 Methanopyru...
O27227            80 EVQGHITGQSIEALHQNGVdPDKRnIIGATGAIPYIENIPDEGIERFQKQL-EIVNLIDVEDADAIKAKVKECIEKDPGA 158 Methanother...
D3E045            80 EVQGHITGQSIQALHENGCdPEKKkITGATGAIPFVENIPMEGVERFQQQV-ELVDLIDNEDGGAITAKVKECIEKDPGA 158 Methanobrev...
NZAGRC:Abm4_1521  80 EVQGHITGQCFEALHANGCdPEKKkVNGAIGAIPFVDNLPLEAVERFQNQV-ELISMIDNEDVGAITAKVKECIEKDPGA 158 Methanobrev...
Q2NI29            80 EVQGHITGKTVEALYENGIdEEKKsIIGSPGAIPFVENLPVEAVERFQKQV-SIVSMINNEDVSEISSKIDECISNDPGA 158 Methanospha...
5L8X_A           162 IDEDPFIIELE 172 Methanocaldococcus jannaschii DSM 2661
WP_004079630     158 FDGEPIVLEVK 168 Methanoplanus limicola
WP_011833921     158 FAADPIVIQLT 168 Methanocorpusculum labreanum
Q2FRN2           158 FDAEAMIVEIK 168 Methanospirillum hungatei JF-1
A6UWH7           160 FEEDPMILDLE 170 Methanococcus aeolicus Nankai-3
O32867           164 YEEGPMTISLE 174 Methanopyrus kandleri AV19
O27227           159 FEEEAMVIKVE 169 Methanothermobacter thermautotrophicus str. Delta H
D3E045           159 FEEDAMVIEVK 169 Methanobrevibacter ruminantium M1
NZAGRC:Abm4_1521 159 IEEEAMVIDVS 169 Methanobrevibacter sp. AbM4
Q2NI29           159 YDEDAMIVEFN 169 Methanosphaera stadtmanae DSM 3091
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap