Conserved Protein Domain Family
MtrD

?
pfam04207: MtrD 
Tetrahydromethanopterin S-methyltransferase, subunit D
The N5-methyltetrahydromethanopterin: coenzyme M (EC:2.1.1.86) of Methanosarcina mazei Go1 is a membrane-associated, corrinoid-containing protein that uses a transmethylation reaction to drive an energy-conserving sodium ion pump.
Statistics
?
PSSM-Id: 398057
Aligned: 25 rows
Threshold Bit Score: 220.251
Threshold Setting Gi: 501054612
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004037739      41 LAAVIGVIIGGALIGFGVHFVPVGGAPAAMGQSPGIATGVAMLAAGAGLAGLFGGAWAAANPAf------GIAIVIAAGA 114 Methanofoll...
jgi:Mfer_0782     13 ITLVAALTLGGMSVFAGVHLVPVGGASGAMATSSGIPTGTTQLAAGASMTGLIVAGMALKK---------PLWMILLAGG 83  Methanother...
O27230             4 LLLIGAITAGGVLIGGGVHFVPVGGAPAAMATATGVGTGTAMLAAGAGLTGLITAAAMTGQ---------SPLMIMAAGA 74  Methanother...
Q2NI33             3 feLLISIIIGSTLIGFGVHFIPVGGAPAALSTTAGVPTGAPMITIGMGITGILSALSMTGQ---------SEIVIILSGA 73  Methanospha...
NZAGRC:Abm4_1524   3 LIMMLLIIIAGVCMGAGVHFIPVGGAPAAMSTATGVGTGTAMLAAGAGMTGLITAASLEGA---------GLGLILLAGA 73  Methanobrev...
agres:mru_1922     4 LIFIICVVIAGIIMGGGVHFIPVGGAPAAMATATGVGTGTAMLAAGAGLTGLITAASMTGQ---------PVWLIVLAGA 74  Methanobrev...
Q58258             7 IVPLIEMTIAGAIINASVHFIPVGGAPAAMATSTGVGTGTTQLAAGAGFTGLMGAAVMASNVGls---piGMALIMISGA 83  Methanocald...
Q6LWZ3             7 ILPLAEITIAGAIINASVHFVPVGGAPAAMATSTGVGTGTTQLAAGAGFTGLLAAAAMASQAGvslsnpvHMLLIMLSGA 86  Methanococc...
O32864             5 IAVLVLITLGSIMVNVGVHYVPVGGAPAAMATATGVGTGTTQLAAGSGLTGLITAAAMSQK---------PFLVILWNGA 75  Methanopyru...
Q12VU5            12 ILYIAMVTLGGMLISWSVHFVPVGGAPAAMAQATGIGTGTVQLAAGAGLTGLVTAGAVMAVSD-------SLLLVVASGG 84  Methanococc...
WP_004037739     115 VGGGLMMAITCLMVNIIYIFGMGIPAASGKVAKDPITGDSQAEYKSQGTEGHGLPFVSYVGGVIGGLLGGAGGTLIYYEL 194 Methanofoll...
jgi:Mfer_0782     84 IGASVMITLTGLFTNICLVYGIGSVPTIAKRKKDPITGWNQEKYVTPGTEGHGAPTSAYISGAMGAFLGGVGGALVYWAL 163 Methanother...
O27230            75 VGSMLMIGITMLVGNLIYVYGVGTVPVSAKVAVDPLTGMEQEKYVTPGTEGHGLPTVCFVSGIIGGALGGIGGGLIYWAL 154 Methanother...
Q2NI33            74 IGSMLMMAVTMFFSNMIHVYGVGVPLASSNFERDPITGFKQEEYVSPGTTGHGIPTVSFISGVIGALFGGIGGSLAFWAI 153 Methanospha...
NZAGRC:Abm4_1524  74 IGSMMMMGITMLFGNFIYVFGVGVVPSSGKVEKDPITGLPQAAYKTPGTEGHGVPTVSFVSGIIGSALGGIGGGMAFYAV 153 Methanobrev...
agres:mru_1922    75 VGSMLMMGITMLIGNFIYIFGVGVVPASGKAAVDPITGWNQEKYKTPGTEGHGIPTVCYISGIIGGLLGGAGGGLVYWAI 154 Methanobrev...
Q58258            84 VSSMIMLGVTMLIGQLIYVFGVGVVPAADKCEIDPITKDPQKPYVTPGTTGHGVPTVCFVSGLIGAALGGIGGALAYIAL 163 Methanocald...
Q6LWZ3            87 VGAMIMLGLTMLIGQIIYVYGIGIVPAADKCEKDPITGDIQKPYITPGTTGHGIPTVCFVSGTIGAALGGLGGALAYIAL 166 Methanococc...
O32864            76 LGAATMMAITMLVGNFIYVYGVGCPPCSAKVDKDPITGWDQEAYVTPGTEGHGIPTVSFVSGILGGLLGGSGGAMVYYAL 155 Methanopyru...
Q12VU5            85 VGAMIMIAVTMIVGTWVYVYGVGVPPASAKVDYDPITKDRQDIYVSQGTEGHGLPTVSYVSGVIGGALGGIGGSAIYFAL 164 Methanococc...
WP_004037739     195 LqvySAMLPAMFNAsaeeilpiAVSLAGIFAVGMFLVNAVLAAYNITGTIEGPHDPKF-KRFPRAVIGCAVAS 266 Methanofollis limi...
jgi:Mfer_0782    164 YhalVTIPYFGDLG--------AKAIAVAYALGMFFVNAVLASYNIGGTTEGLWDPKI-HRLPRGIVGSLIVS 227 Methanothermus fer...
O27230           155 NealKTLSYGAIG---------AAGVAAIFAVGIFFINAVIASYNIGGTIEGFHDPKF-KRIGRGIVACLIAS 217 Methanothermobacte...
Q2NI33           154 YnyiLGNCHLSSIY--------TNSISAILAVMLFFIIAVVASYNIGGTIQGFYDKKFrKKIVSGTFSCFLIS 218 Methanosphaera sta...
NZAGRC:Abm4_1524 154 QemaKNSTLFAGNMp------vIIGVAAICSIGLFFVNSVVASYNIGGTIEGFHDPKF-KRIGNGALASIIAS 219 Methanobrevibacter...
agres:mru_1922   155 NefaTANLTGFDATv-------IAGLAAILSVGMFFINSVTASYNIGGTIEGFVDPKF-KRLPTGILACAVVS 219 Methanobrevibacter...
Q58258           164 RklgL-----------------DPGVAGMLAVGFFFINAVLASYNIGGTIEGFHDPKF-KKMPNGVIASTVAS 218 Methanocaldococcus...
Q6LWZ3           167 QqlgF-----------------AAAIAGVLAVGFFFMNAVLASYNIGGTIEGFHDPKF-KKMPNGVIASFVSS 221 Methanococcus mari...
O32864           156 YkvlGM----------------SAALAGILAMGFFYANAVLASYNIGGTIEGYHDPKF-TRLPKAVVCSLVFG 211 Methanopyrus kandl...
Q12VU5           165 M---STSTTLIQSD--------LVALASIFAVGIFFVNAVIPSYNIGGTIEGFHDPKF-KKWPKAVLASFVAT 225 Methanococcoides b...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap