Conserved Protein Domain Family
Mfp-3

?
pfam04202: Mfp-3 
Foot protein 3
Mytilus foot protein-3 (Mfp-3) is a highly polymorphic protein family located in the byssal adhesive plaques of blue mussels.
Statistics
?
PSSM-Id: 112992
View PSSM: pfam04202
Aligned: 2 rows
Threshold Bit Score: 64.9835
Threshold Setting Gi: 74825410
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9NAU3  1 MNNSSVSVLVALVLIGSFAVQSDAADYYGPNYGPPRRYGGgyYNRYNRYGRRYGGYKGWNNGWKRGRRGKY 71  Mytilus edulis
Q9NAT6  1 MNNTSVSVLVVLVLIGSFAVESDAAAYYGPNYGPPRRYGG--YNGYNRYARGYGGNRGWNRGWNRGWRGRR 69  Mytilus edulis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap