4OQQ,2OKG,4L5J


Conserved Protein Domain Family
Sugar-bind

?
pfam04198: Sugar-bind 
Click on image for an interactive view with Cn3D
Putative sugar-binding domain
This probable domain is found in bacterial transcriptional regulators such as DeoR and SorC. These proteins have an amino-terminal helix-turn-helix pfam00325 that binds to DNA. This domain is probably the ligand regulator binding region. SorC is regulated by sorbose and other members of this family are likely to be regulated by other sugar substrates.
Statistics
?
PSSM-Id: 398049
Aligned: 23 rows
Threshold Bit Score: 225.959
Threshold Setting Gi: 122983991
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4OQQ_B         7 DPFEDLDALGSILEEKYGLLEAHVVfsPTPDy-------AGITHDLSRYGAEYMHETVKDGD--IVGVSWGTTMYQIAQN 77  Bacillus subtil...
Q9RT33        86 DPQGHPCSLQARLMERWPGVQAQVVglPPHSt------qDLRLERVALAAAHWLGSALRPGL--VVGLAWGNTLDAVSRA 157 Deinococcus rad...
Q9CGB1        54 SPIERSFELEKQFKTLFDIPQIYII--KDVEdg--------nSESLIKFAAKRIESHILNSQ--TVGTVWGETIFRIIDH 121 Lactococcus lac...
P39356        63 VNVFGSIDAALQIRDKFNLQRVIIV--PDGEhagkrddtKLMRTRLSRAGGMYLNQVIENGD--VLGVAWGRTIHQMSKT 138 Escherichia col...
Q9L0Z6        89 VPAELDAERSDALRARYGLRHAVVV--ESPAda----eeTPDPENLGEVAADLLGELVNEGD--VLGLAWGRSTIHMAAA 160 Streptomyces co...
Q9WWA6        83 SPYVSSPMLEKELVAKFDLRKAVVV--PAPVr------pDSTPEAVGAGIGQYLNARLSDQm--SLGIISGRTFHAALSA 152 Agrobacterium t...
Q9CLG2        68 SRFTGCLELEEALKEHFQLKHIRIL--PALEk-------NEINERLGIGASQMLMSMLKPNQ--RLAIGFGETIMQTIKH 136 Pasteurella mul...
4L5J_A        67 SRFEGCLEYETQLRRQFSLQHVRVI--PGLAd-------ADVGGRLGIGAAHMLMSLLQPQQ--MLAIGFGEATMNTLQR 135 Escherichia col...
Q2YIQ4        56 gdITECIDLENRLADLYGLDYCEVA--PDIGe------eGLPLMALGHAGANFMRREIEHGDheVIGIGHGRTLSAAVGY 127 Brucella abortu...
WP_004144198  59 HPVANCLDYAQLLQEKYRLIECNVV--PAFSe-------ESTLDSVSFGCYQLMARYLQDDKekIIGLGSGLTLKKALQR 129 Enterobacteriaceae
4OQQ_B        78 MQP-KQVKGVEVVQLKGGISHsR--VNTYSAETIQLFAEAF-QTMPRYLPLPVVFDNADVKRMVEKDRHIERIIEMGKQA 153 Bacillus subtil...
Q9RT33       158 LTP-RPLSGVQFVQLNGSASV-LelSSGFVGGTLTRLAQAV-RGQAHLFPVPTFFDDPATKQAMWRERSVQHVVQLQRQA 234 Deinococcus rad...
Q9CGB1       122 FTP-QEHSDLLFTQMMGENRK-Yh-SAAGSMrMVEKAAKQF-SAQYVTLSGPLYITNPAVRKGMTEEIASQPAFTTAKRM 197 Lactococcus lac...
P39356       139 MTP-KSCKNVTVIQMLGSMPSq--pD-LTIIESSSQIAYKL-SGRVASLHVPAVVSSARLAMELQAEPIIRSNFDVLTRC 213 Escherichia col...
Q9L0Z6       161 LDR---LPPCTVVQLTGVYDA-Gt-AERGSVeAVRRAAQVS-GGDAHPIYAPMLLPDAATAQALRHQTGIARAFEYFDKV 234 Streptomyces co...
Q9WWA6       153 LEA-RAIPGLSIVSMIGGLTVk--aA-MRPYEVAHQLAQIY-QAECYYMPAPTYAESKKARDEFLAQSLVQEIMRRAAAV 227 Agrobacterium t...
Q9CLG2       137 SNEfITHNHLKLITLSGGVGP-Y----------MKGIGQLDgSCSVSIIPAPLRASSIEAAKLFKREACVRDIMLAACHA 205 Pasteurella mul...
4L5J_A       136 LSGfISSQQIRLVTLSGGVGSy--mTG---------IGQLNaACSVNIIPAPLRASSADIARTLKNENCVKDVLLAAQAA 204 Escherichia col...
Q2YIQ4       128 MPR-VMANDLRFVSLLGGLTRn--fA-ANPHdVMHRIAEKT-GMPAYVMPVPFFANTAEDREVLLAQRGVTTVFDMGCRA 202 Brucella abortu...
WP_004144198 130 IDF-DSLN-TRCVALISAMNAd--gQCNYYDdVPLLLTRKI-KAKYYQWPAPRYAQSADEYEMWCTNRLFRSVSGVAREA 204 Enterobacteriaceae
4OQQ_B       154 NIALFTVGTVRD--EALLFRLGYFNEEE-KALLKKQAVGDICSRFFDAKGNICS-SAINDRTIGVELQDLRLKERSILVA 229 Bacillus subtil...
Q9RT33       235 ELLLFSVGSPHAalPSHVYAAGYLDPDDlTQLEREGAVGDIATMFFRADGSWDG-LSLNARSSGPDLALIRDHPNTACIV 313 Deinococcus rad...
Q9CGB1       198 DLIFSGLGTLASvnSIPIWEQH--TNEIfPDINLGAIAGMAYGRPYDINGNILV-TPENDCVFGVDMKTIFQPPKRVGVV 274 Lactococcus lac...
P39356       214 TKAFFVVGNALD--ENPLIRVGVLNKKEmQTYRDLGAVGVICGRFYDKEGMPVV-ADVDQRILGISLAQLRQIERKIFLA 290 Escherichia col...
Q9L0Z6       235 TVACVSIGSWEP--GISTV-HDMLSDEErAHYASLGVAAEMSAHLFDAEGRRVG-RDLGERCITVKADQLRRIPEVVAIA 310 Streptomyces co...
Q9WWA6       228 DIAIIGVGRLTE--DGVIRAYDLLQEEEmDSLVQAGAVGSFVGWFINKDGTLVE-HALNDRVIGLPLDRLKDLPEVVLCG 304 Agrobacterium t...
Q9CLG2       206 DAAIVGIGATRQkgQATLLRTGYITEEKqRLIREQGAVGDILGYFMQKDGQLQPdMPLHEELISVTLDNLKKIPNVIGIA 285 Pasteurella mul...
4L5J_A       205 DVAIVGIGAVSQqdDATIIRSGYISQGEqLMIGRKGAVGDILGYFFDAKGDVVTnIKIHNELIGLPLSALKTIPVRVGVA 284 Escherichia col...
Q2YIQ4       203 ELKIVGIGTVDA--QAQLVTSGMIELGEvEEIANLGGVGEMLGHFFNANGQWLE-TALTGRTIAASVENA-DMSRIVALA 278 Brucella abortu...
WP_004144198 205 DVIFVGIGPLGT--QSPIFKDGFINQAQmDELTARGGIGEILGRFIDAQGDVVD-SEINRMITSYDIRQS--HCPRIAAA 279 Enterobacteriaceae
4OQQ_B       230 GGSRKVSSIHGALTGKYANVLIIDQHTARALVN 262 Bacillus subtilis subsp. subtilis str. 168
Q9RT33       314 ADPGKAAALRAALDGGLLRTLIVDETTAAGVLG 346 Deinococcus radiodurans
Q9CGB1       275 KSKFKTQATLGALRGKFFTELIISESIAERILA 307 Lactococcus lactis subsp. lactis
P39356       291 GGERGYDATLGALLGGYVTDLIVDEGTAEFLLA 323 Escherichia coli K-12
Q9L0Z6       311 GGQRKAAAIDAVLRSGLVTSLVTDTSAADYLMT 343 Streptomyces coelicolor
Q9WWA6       305 GGIGKAQALAAVLRAGYADVLITDEAAARRLVS 337 Agrobacterium tumefaciens
Q9CLG2       286 GGEDKVEAILSALYGQHINSLVTEEKTARMMLA 318 Pasteurella multocida
4L5J_A       285 GGENKAEAIAAAMKGGYINALVTDQDTAAAILR 317 Escherichia coli K-12
Q2YIQ4       279 GGLSKVDAIRAVLKSGRLYGLITDERTAKALIg 311 Brucella abortus 2308
WP_004144198 280 CGEHKRPAILAALKGGWINGLVTDEHTARWLLt 312 Enterobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap