Conserved Protein Domain Family
Transposase_28

?
pfam04195: Transposase_28 
Putative gypsy type transposon
This family of plant genes are thought to be related to gypsy type transposons.
Statistics
?
PSSM-Id: 398047
Aligned: 16 rows
Threshold Bit Score: 70.0166
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KXG25901      84 VIlSLTHIICGLRLDASDFLVSVLNHYRLEWSHLTPNSITALSLFAHLCESYMEVPPTVEVFTHFYSLYR 153 sorghum
3_pfamImport   1 VC-HIACAAGSLVHPFSDFFLNILEIDGLQMLHLNPNVVMTLSMFAYFCKMFVGVRLLVDLFRRFFMARY 69 
2_pfamImport   1 IF-VVSFALVGLVPPFSPFFYDVLHFYGIQMLHLGPNSIFILAIFAHLCEMFVRVMSMLPLFRHFFMLCQ 69 
1_pfamImport   1 VF-MVPFALAGLVPPFSSSFYDVMVFYQIHMLHLGPNSILTVSIFAYLCEKFAAHAPHLLAFFHPLSANV 69 
6_pfamImport   1 IV-FASFFERGFSLPVSSFSHSLLDFYKLELNHLNPNFILQIYVFVYICESFLGIPPYFNLFHHLFMVRP 69 
5_pfamImport   1 VV-FSSFFERGFSLPISSFCG-LLDFYKLELHHLNPNSILHISIFVYIRETFLGIPPHFNLFCHLFRVKP 68 
KXG19222      48 VV-FADFFERGFSLPTHPFFRRLLRYYGLQLHHLNPNGMLHISIFITLCEAYLGIEPHFGLWRWLYCVRP 116 sorghum
KXG19431      83 ICvNEHALEAGMRVPLHAFFCEVLAHFGVAPIQIAPNGWRAMAGFIVLSHK-AGVAPSLPVFRHFFSLCG 151 sorghum
BAS96324      88 VCvYKDALEAGMRVPLHPFACDVLRHFGLAPSEVTPNGWRIMAGFLVLSHH-AGVPPSLAVFRHFFKLCL 156 Japanese rice
BAJ91496      78 ICvYARSLEAGMRLPLQGFFSDVLAHFGIAPAQLTPNGWRAMAGFLALCDY-AGVPPSLAVFRRFFVMCS 146 domesticated barley
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap