2KHD,2JZ5


Conserved Protein Domain Family
DUF406

?
pfam04175: DUF406 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF406)
Members of this family appear to be found only in gamma proteobacteria. The function of this protein family is undetermined. Solution of the structures of the two members of this family investigated bear some resemblance to that of the single domain enzyme pterin-4a-carbinolamine dehydratase, PDC. Although the residues of PCDs involved in binding of metabolite are not conserved in the two structures under study, they do correspond to a surface-region structurally aligned with residues that are highly conserved, eg Glu 89, suggesting that this region is also involved in binding of a ligand, thereby possibly constituting a catalytic site of a yet uncharacterized enzyme specific for gamma proteobacteria.
Statistics
?
PSSM-Id: 398030
Aligned: 38 rows
Threshold Bit Score: 84.9959
Threshold Setting Gi: 307632126
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2KHD_A          8 ENEVCEACGCAGEIGFIIREGDDVAEVSLFGSDKAHLEGKLAEYISLAKQVYANV-EYEVAPVADNATELHARFKFEVSA 86  Vibrio cholera...
WP_015464437    9 TTDVCEACGSFVELGSVINADDTVFVLPFKGSSLDGVNKMAKKYIDAAKKRFESViISTEETQKEEIFHIEVTFTFECTA 88  Psychromonas s...
ABM02723        7 ADDICEACGSFVELGSVISDDDTVLVLPFTGKESVAVTALAIKYIDAAKTRFDSVvVTEQEITADDLVTLEVTFNFDCTA 86  Psychromonas i...
jgi:Fbal_2225   6 qdLITECCGAYMDVGAVISEEDTVLSLPITAASEADARAEFEKLEAAAKARFADV--QTDAQWQQETGTLQARLVFSCAA 83  Ferrimonas bal...
jgi:Tola_0083   7 MEEVCEACGCVAEVGTIIRDGDDLVMIPVEGDNEEDARARQERYIAVAKEACPDVlVSSELQTVEDGVVLNTTLQFTCTA 86  Tolumonas auen...
WP_011704341    9 LNETCDSCGCFAEIGTIIGEGDDVMELVIEAAAEADARAKLAAYEALAKQVTAEAtSSSELSQGANGVILKARLQFTCTA 88  Aeromonas
CCO60644        7 ENQVCEACGCSAEMGFIIKEGDDVAQVTLYGAEDSQLDAELNKYVELAKTVSDEV-QHETQKLEGESG-LQVRFKFTCSA 84  Vibrio nigripu...
Q5DZY2          7 QNVPCEACGCSAEMGFVIKEGDDVAEVSIFADNKVLLESEFSNYLALAKEVCADV-EHSIV-ITEDEKELHARLKFSCSA 84  Aliivibrio fis...
Q6LK04          7 EFQPCDACGVSAEVGFIIKEGDDVAEVSIFAQGKVALENEFNNYLALAKEVNANF-EYQASELTEESTELTAHIKFECSA 85  Photobacterium...
CAV25674       21 NNDVCEACGCAGEIGFIIKEGDDVAEVTVYGNSKALIETEFAKYVELAKQVSSNV-EFEASELTEESTELNARFKFEVSA 99  Vibrio tasmani...
2KHD_A         87 EKLIFELKTR 96  Vibrio cholerae O1 biovar El Tor str. N16961
WP_015464437   89 EKLIFEMGLs 98  Psychromonas sp. CNPT3
ABM02723       87 EKLIFEMGLs 96  Psychromonas ingrahamii 37
jgi:Fbal_2225  84 ERLIFEMQLn 93  Ferrimonas balearica DSM 9799
jgi:Tola_0083  87 EKMIFEMRAR 96  Tolumonas auensis DSM 9187
WP_011704341   89 EKLIFEMRAR 98  Aeromonas
CCO60644       85 EKLIFELKTR 94  Vibrio nigripulchritudo
Q5DZY2         85 EKLIYELKTR 94  Aliivibrio fischeri ES114
Q6LK04         86 EKLIFELKSR 95  Photobacterium profundum
CAV25674      100 EKIIFELKTR 109 Vibrio tasmaniensis LGP32
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap