Conserved Protein Domain Family
CP_ATPgrasp_1

?
pfam04174: CP_ATPgrasp_1 
A circularly permuted ATPgrasp
An ATP-grasp family that is present both as catalytically active and inactive versions. Contextual analysis suggests that it functions in a distinct peptide synthesis/modification system that additionally contains a transglutaminase, an NTN-hydrolase, the Alpha-E domain, and a transglutaminase fused N-terminal to a circularly permuted COOH-NH2 ligase. The inactive forms are often fused N-terminal to the Alpha-E domain.
Statistics
?
PSSM-Id: 398029
Aligned: 8 rows
Threshold Bit Score: 513.865
Threshold Setting Gi: 501362364
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6N7S9          71 PRILSAQEWARMELGLKQRVRALNMFLRDIYHGRDILRAGVIPDDLIFQNPVFRPEMNGQAVPHDVYVHIAGIDIVRVDD 150 Rhodopseudomo...
jgi:Hneap_1312  81 PRVFGANEWRRLELGLKQRVRALNMFLHDIYHDQEIIKAGVIPASQVLGNSMYCAAMQGVDLPNQVYAQIAGIDLVRVAE 160 Halothiobacil...
Q8Y0C3         108 PRIFPAGEWATLERGLRQRVDALNRFLYDIYHAQDIIRAGLIPPDQIYNNAQYRPDMLGVDVPRDIYAHVAGIDIVRAGE 187 Ralstonia sol...
ACI98766        77 PRIISAAEWARLEAGVQQRVKALNLFLHDIYHDQKILKDGIVPADLVLGNHNFRPQMIGLDVPFGTYIHIMGVDLVRDDA 156 Rhodospirillu...
Q0RH44          80 PRLLDGDEWDVIERGVTQRVQALEAFLADVYGPAEVLADGIVPRRLVLTSAHFHRAAHGIDPPNGVRAHVSGIDLIRDEQ 159 Frankia alni ...
P9WLA9         100 PRVISAPEWTRLERGITQRVKALECYLDDIYGDQEILRDGVIPRRLVTSCEHFHRQAVGIVPPNGVRIHVAGIDLIRDHR 179 Mycobacterium...
WP_012393930   115 PLVVSAQDWEVLEAGLVQRSRLLDAVLADLYGPRRLLTEGLLPSELVFGHPAYVRGANGIEVPGHHQLFLHGCDISRIPD 194 Mycobacterium...
BAF39131        50 PRIIESDEFDRMEAGLKQRVNALNAYLRDIYSDKQAIKDGIVPEEYVYTSAGYFPQVNGVTPPGGVFAHIAGEDLVQGQD 129 Bifidobacteri...
Q6N7S9         151 EHFYVLEDNARTPSGVSYMLENREIMMRLFPDLFARHRIAPVERYPDELLTALRSVAPTHSsSEPTVALMTPGVFNSAYY 230 Rhodopseudomo...
jgi:Hneap_1312 161 NDFYVLEDNLRTPSGVSYMLENRNTMMRLFPNMFTQRTIQPVAHYPQILLETLRESGPAHI-ENPVIVVLTPGPYNSAYF 239 Halothiobacil...
Q8Y0C3         188 GEFYVLEDNLRVPSGVSYMLENRKMMMRLFPELFARNRVAPVAHYPDLLLDTLRSVSPQSI-SDPTVVVLTPGMYNSAYF 266 Ralstonia sol...
ACI98766       157 GTFRVLEDNGRVPSGVSYVVENRHMMMRAFPDLMSDIGIRPVDNYGVKLLEAMCEIAPADA-TDPHVALLSPGPYNSAYF 235 Rhodospirillu...
Q0RH44         160 GGFRVLEDNVRVPSGVSYVIENRRAMTRVFPELFATHRVRPVADYATHLLHALRAAAPPEV-ADPTVVVLTPGVYNSAYF 238 Frankia alni ...
P9WLA9         180 GDFRVLEDNLRSPSGVSYVMENRRTMARVFPNLFATHRVRAVDDYASHLLRALRNSAATNE-ADPTVVVLTPGVYNSAYF 258 Mycobacterium...
WP_012393930   195 GSYQVNADWTQAPSGAGYALADRRVVAHAIPDLYENIAPRPTTPFAQALRLALIDAAPDVA-QDPVVVVLSPGIYSETAF 273 Mycobacterium...
BAF39131       130 GQWWVLEDNLRIPSGASYLLFARDIERRITPSLFRNVRVRDNRDYPRLLRQSMDFVSTDG-----IAVVLTPGRYNSAFF 204 Bifidobacteri...
Q6N7S9         231 EHSFLADKLGIELVEGRDLVVKNDEVFMRTTEGLK-RVDVIYRRVDDDFIDPLTFRPDSVLGVPGLMSAYRAGNVTLANA 309 Rhodopseudomo...
jgi:Hneap_1312 240 EHAFLASQMGVELVEGKDLFVSNNKVYMRTTQGAQ-QVHVIYRRVDDDFLDPLAFRADSVLGVPGLFDAYRHGGVSLTNG 318 Halothiobacil...
Q8Y0C3         267 EHAFLAQQMGVELVEGHDLFVKDDHLYMRTTQGPQ-RIDVIYRRVDDDFLDPLVFRPDSQLGAAGLLSVYRAGNVTICNA 345 Ralstonia sol...
ACI98766       236 EHIFLAREMGVPLVEGRDLVVQNDRVYMRTTNGLE-RVDALYRRVGDDFLDPLAFNPDSCLGVPGIFEAYRKGNVALANA 314 Rhodospirillu...
Q0RH44         239 EHALLARQMGVELVEGRDLTVRDNKVTMRTTEGEQ-PVHVVYRRVDDDWLDPLHFRPESMVGCAGLVNAARGGHVTIANA 317 Frankia alni ...
P9WLA9         259 EHSLLARQMGVELVEGRDLFCRDNQVYMRTTEGER-QVDVIYRRIDDAFLDPLQFRADSVLGVAGLVNAARAGNVVLSSA 337 Mycobacterium...
WP_012393930   274 DQAYLATLLGFPLVESADLVVRDGKLWMRSLGTLK-RVDVVLRRVDAAYADPLDLRADSRLGVVGLVEAQHRGAVTVVNT 352 Mycobacterium...
BAF39131       205 EHAYLAEKTGAALAFPEDLEVVDNKVYFLDYAGRKhRVGVVYRRLSDEYLDPFAFNPDSVIGVPGILSAYRSGNVAIVNA 284 Bifidobacteri...
Q6N7S9         310 VGTGIADDKAVYSYMPDIVKFYLDEEPILKNVPTWRCREPSDLAYVLDHLSELVVKEVHGSGGYGMLIGPTATK-ATIEA 388 Rhodopseudomo...
jgi:Hneap_1312 319 VGTGIADDKSTYLFVPEMIEFYLGEKPLLSNVPTWRLDRSDDLKYVLEHLPELVVKEVQGSGGYGMLVGPTSSSkEIEAY 398 Halothiobacil...
Q8Y0C3         346 IGTGVADDKSIYPYVPDMIRFYLGEAPILNNVPTYMCRRPDDLQYVLDHMGELVVKETHGAGGYGMLVGPAATQ-EEIAA 424 Ralstonia sol...
ACI98766       315 IGTGVADDKAVYAYVPRMIRYYLGEEAIIPNVETHICREPEALKYTLDNLDRLVVKPVGEAGGYGITIGPMASK-AELED 393 Rhodospirillu...
Q0RH44         318 VGNGVADDKLMYTYVPELIRYYLGEEPILPNVDTYRLEDPDQRAHVLDHLDTLVVKPVDGSGGKGIVIGPQASD-AELAE 396 Frankia alni ...
P9WLA9         338 IGNGVGDDKLVYTYVPTMIEYYLHEKPLLANVETLRCWLDDEREEVLDRIRELVLKPVEGSGGYGIVFGPEASQaELAAV 417 Mycobacterium...
WP_012393930   353 LGSGILESPGLMRFLPGLAERLLGEEPMLQSAPMYWGGIATERSHLLANLSSLLIKSTV---GGNTRVGPTLSSaQLAEL 429 Mycobacterium...
BAF39131       285 PGNGAADDKAIYYFVPNMIRYYLGEEPILHNAPTYMPMFDKDRKEVLDRLGELVIKDVAEAGGYGVVFGSSLDRsQREEL 364 Bifidobacteri...
Q6N7S9         389 FREKLKREPeGFIAQ 403 Rhodopseudomonas palustris
jgi:Hneap_1312 399 RARILENPA-GFIAQ 412 Halothiobacillus neapolitanus c2
Q8Y0C3         425 FREVVKARPgQYIAQ 439 Ralstonia solanacearum
ACI98766       394 CRAKLLADPaNYISQ 408 Rhodospirillum centenum SW
Q0RH44         397 LRVRVSEDPrGWIAQ 411 Frankia alni ACN14a
P9WLA9         418 SQKIRDDPR-SWIAQ 431 Mycobacterium tuberculosis H37Rv
WP_012393930   430 AARIEAMPW-QWVGQ 443 Mycobacterium marinum
BAF39131       365 AERIKAEPR-RFIAQ 378 Bifidobacterium adolescentis ATCC 15703
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap