Conserved Protein Domain Family
Nop14

?
pfam04147: Nop14 
Nop14-like family
Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production.
Statistics
?
PSSM-Id: 398014
Aligned: 116 rows
Threshold Bit Score: 548.387
Threshold Setting Gi: 347963742
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q54K79        27 TPVVKIVNPFDRKVNKTKHVVLNRQVKGASGDLGQSRYNAIEKRKKTILVEMNQMNKSNKFIDARIGENDASMSEEDKML 106  Dictyostelium ...
XP_006627260  19 TATEIKNNPFEVKINRKKFDVLGRKTKHDVGLPGVSRSKAIKKRKETLLKEYKLKNKANKIIDRRFGEYDTKMAPEEKIL 98   spotted gar
XP_003965217  19 TSTEIKNNPFEVKINRKKFDVLGRKVKHDVGLPGVSRSKAITKRKETLLKEYKQKNKSSKFIDRRFGEYDTKMAPEDKIL 98   torafugu
XP_004074632  19 TNAAIKNNPFEVKINRKKFEVLGRKTKHDVGLPGVSRSKAINKRKETLLKEYKQKNKASKFVDRRLGEYDAKIAPEDKIL 98   Japanese medaka
XP_005812725  19 AASEIKNNPFEVKINRKKFDVLGRKSKHDVGLPGVSRSKAINKRKETLLKEYKQKNKSNKFIDRRLGEYDAKMTPEDKIL 98   southern platy...
XP_003455004  19 TSSEIKNNPFEVKINRKKFDVLGRKSKHDVGLPGVSRSKAVNKRKETLLKEYKQKNRSSKFIDRRFGEYDTKMAPEDKIL 98   Nile tilapia
XP_003461905  16 APAKTSPNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARAIRKRTQTLLKEYKERDKSNVFKDRRFGEYDHSLSPEEKMT 95   domestic guine...
XP_003773477  23 AKPSANPNPFEVKINRQKFQILGRKTRHDVGLPGISRAKAIKKRTQTLLKEYKERDKSNVFTDKRFGEYNTKISPEEKMM 102  Tasmanian devil
XP_014345247  18 TSTSIKNNPFEVKINKQKFNILGRKTKHDHGLPGVSRSKAIKKRKETLLNEYKQKDKSNTFIDKRFGEYDTKLAPEEKMM 97   coelacanth
XP_030841150  19 KATEIKNNPFEVKINKQKHNILGRKNKHGKGVPVVSRSKGLQKRNATLLQEYKQRHKSNKFLDKRLGENDPEMSVEDKMM 98   purple sea urchin
Q54K79       107 ARFQREKlr---nKNLYNLNDNDQeeLTHMGQSLGNslgsnsmslSEGNDDYVASD--DELDEVGKEFLSERQRF----G 177  Dictyostelium ...
XP_006627260  99 KRFALERqrihdkKDIYNLNEEEE--LTHYGQSLAD---------IEKLNDVVESDsdTEEKGLLSAELTA-SHFg--gG 164  spotted gar
XP_003965217  99 QRFAMERkrsydkKDVFNLNEDEE--LTHFGQSLAK---------METFNDFVNSDdeSEEKGLLSAEMTA-SHFg--gG 164  torafugu
XP_004074632  99 QRFALERqrihekKDMYNLNEEEE--LTHYGQSLAE---------MEKFNDMVNSDdeSEEKGLLSAELTA-SHFggggG 166  Japanese medaka
XP_005812725  99 QRFAIERqrshgkRDVYNLNEEEE--LTHYGQSLAE---------IEKFNDTVGSDdeSEEKGLLSAELTA-SHFg--gG 164  southern platy...
XP_003455004  99 QRFTMERqrvhekKDVYNLNEEEE--LTHYGQSLAE---------MEKFNDAVNSDdeSEEKGLLSAELTA-SHFg--gG 164  Nile tilapia
XP_003461905  96 ARFALEQqrhhekKSIYNLNEDEE--LTHYGQSLAD---------IEKHSDIVDSDsdTDGPGALSAELTT-AHFg--gG 161  domestic guine...
XP_003773477 103 KRFALERqrnnekKSIYNLNEDEE--LTHYGQSLAD---------IEKFNDIVDSDsdTEERGMLSAELTA-SHFg--gG 168  Tasmanian devil
XP_014345247  98 KRFALERqrnhekKNIYNLNEDEE--LTHYGQSLAD---------IEKLKDIPDSDsdTEEKGMLSAELTA-AHFg--gG 163  coelacanth
XP_030841150  99 ERFTLEKqrnhekSGMYSLNTDED--LTHYGQSLSS---------LEKFEE-PDLAsdDEEGGMIDKKFVAEEHF----G 162  purple sea urchin
Q54K79       178 GGDDDSNGng------erQDRHKSKKEIYQEIIEKSKIGKAERAKEKLKKEALTRDLDEEFNLIRGELILtNGNNSNSSN 251  Dictyostelium ...
XP_006627260 165 GGLLRKKSpheqn-nddgTHKPKTRQELIEEMIVKSKLEKRERQTQREEAQELTEKLDNDWKSIQSLLVH-RTPKSEL-K 241  spotted gar
XP_003965217 165 GGLLRKKTsgdqq-eedgSQRAKSRQELIEELILKSKQEKRERQAQKEEAQVLTEQLDKEWKSIQALMVK-KAPKAESDE 242  torafugu
XP_004074632 167 GGLLRKKTsgeqq-qedgNQRAKSRQELIEELIHKSKQEKRERQVQKEEAQELTEKLDQEWKSIQALMVK-KTAKAEHTD 244  Japanese medaka
XP_005812725 165 GGLLRKKTsggeqedeqgGQKAKSRQELIEELIQKSKQEKRERQVQKEEAQELTEKLDQDWKSIQALMVK-KTPKAEHVD 243  southern platy...
XP_003455004 165 GGLLRKKAsgeq--eeegGQRVKSRQELIEELIQKSKQEKRERQVQREEAQELTEKLDQDWKNIQSLMVK-KTPKA---D 238  Nile tilapia
XP_003461905 162 GGLLQQKTtpq-----eeGGKPKSRKELIEELIAKSKQEKRERQAQREDALELTEKLDQDWKEIQTLLSH-KAPKSGNRE 235  domestic guine...
XP_003773477 169 GGLLRKKTsep----geeEEKPKSRKELIEELIAKSKQEKRERQIQRENALELTEKLDSDWKEIQSLLSH-KTPKWEK-K 242  Tasmanian devil
XP_014345247 164 GGLLKKKApseqt-ekeeEQKPKSRKELIEELIAKSKQEKRERQTQREEALELTEKLDKEWKEIQALMPH-KTPKSAREK 241  coelacanth
XP_030841150 163 GFLTKKKTd--------eEGKPKTRQEIFEEIIAKSKKDKFNRQSEKEDVVKLTEQLDQDFNDVSQFLA-----KVKR-D 228  purple sea urchin
Q54K79       252 NNNLQddaflkfqaeqrsneqkfasssssnstndstkkpkeAHDdFDELLYELQGESRAHATDRTKTKEEQMKEEMERLQ 331  Dictyostelium ...
XP_006627260 242 EADEKp----------------------------------kPDE-YDMIVRELGFEMKAQPSERMKTEEELAKEEKERLQ 286  spotted gar
XP_003965217 243 KPEEKp----------------------------------kLEE-YDMMVRELGFEMKAQPSEKLKTPEELAREEREKLQ 287  torafugu
XP_004074632 245 KPEEKp----------------------------------kLDE-YDMMVRELGFEMKAQPSEKMKTPEELAKEEKEKLQ 289  Japanese medaka
XP_005812725 244 KPEEKa----------------------------------kPEE-YDMMVRELGFEMKAQPSEKMKTPEELAKEEKEKLQ 288  southern platy...
XP_003455004 239 KQEEKp----------------------------------kLEE-YDMMVRELGFEMKAQPSEKMKTPEELAKEEREKLQ 283  Nile tilapia
XP_003461905 236 EEKPK------------------------------------PDA-YDMVVRELGFEMKAKPSNRMKTEVELAKEEQERLR 278  domestic guine...
XP_003773477 243 DKEEKp----------------------------------kPDA-YDMMVRELGFEMKAQPSNRMKTEEELAKEEQARLK 287  Tasmanian devil
XP_014345247 242 PEEEKp----------------------------------kPDE-YDMIVRQLGFEMKAQPSDRMKTEEELAREEQERLE 286  coelacanth
XP_030841150 229 KDEERr----------------------------------kPDD-YDMSVKELIFDMRAKASDRLKTPEELAKEEKEKLE 273  purple sea urchin
Q54K79       332 QKEKERLERASGDYVELEADDNVKDSDKnlprkvldrlkakdnkpkmlTADSLDDENEVLNiNGVdtvfY---------- 401  Dictyostelium ...
XP_006627260 287 KLEADRLRRMQG---DIEEDSTKKVSHL--------------------SADDLNDGFILD--KEDrrtlSyqdgkw--ni 339  spotted gar
XP_003965217 288 KLEADRLRRMMG---DEIGNSTQQQVHM--------------------SADDLNDGFILD--NDDkktlAyqdgkw--ni 340  torafugu
XP_004074632 290 KLEADRLRRMIG---EEEETKAQSQTCM--------------------SADDLNDGFILD--KHDrktlAyqdgkw---n 341  Japanese medaka
XP_005812725 289 KLEADRLRRMMG---DEDGASVQSQVHM--------------------SADDLNDGFVLD--KNDkktlAyqdg------ 337  southern platy...
XP_003455004 284 KLEADRLRRMMG---EEVVEGAQSQIHF--------------------SADDLNDGFILD--KHDkktlAyqdgkwnmge 338  Nile tilapia
XP_003461905 279 KLEAERLRRMLGK---DEDAERKTPKHL--------------------SVDDLNDGFILDR-DDRrllsyk--------- 325  domestic guine...
XP_003773477 288 KLEADRLRRMLG---KEDDENTKKPKHM--------------------SADDLNDGFILN--KDDrhllSykdgk----m 338  Tasmanian devil
XP_014345247 287 KLEAERLRRMRG---DLEDETSSRPKHM--------------------SADDLNDGFILD--KEDkrflAykdskl--te 339  coelacanth
XP_030841150 274 KMETDRQRRMKGITETEEQENKRRMQYL--------------------SADDLNDGFELT--RDNrstlSyrdgvpsfgf 331  purple sea urchin
Q54K79       402 ----NPQIdSDDDNNNKdnsdseddqtneqsseleTDDEDKSDEDEEGEEGDEEDSDLDLKDDEILsgqEDDEEEEEeks 477  Dictyostelium ...
XP_006627260 340 eadeEGEEsGKDEEDLGgeeeedg-----eeggesADEEEEESEEDAESG-----DEGSHSDLDSE---QDSNQEEdeke 406  spotted gar
XP_003965217 341 eeeeEDNEeEDDNEEDGdteegee-----deeegeEDEEGEEEEEEEEEGGVSSEEEDGHSDLESE---NESEEEEpkle 412  torafugu
XP_004074632 342 ieeeEREAvEDEEGETGesgee--------qesdkEEGEEEEEEEEEEAS--SEEEEDGQSDLESE---QESEAEEknlr 408  Japanese medaka
XP_005812725 338 -kwnIEEEtEDDKEEEGetgeeeg-----seaegeNEEDDDDVEEEEEEG--SGEDEDGHSDLESE---QESENEEndee 406  southern platy...
XP_003455004 339 eegeEDDEaEDEEEGEGesdeeqes--daeedeveEEEEEEEEEEEEEEG---SGEDDGHSDLESE---QESENEEeeea 410  Nile tilapia
XP_003461905 326 dgkmnVEE-GVEEERSKga---------------gsQESQEEEEDGEEVDGADSHSDLDSSAESVA---GGTEPAEGqcp 386  domestic guine...
XP_003773477 339 nqeiDDPNeEEQA---Qeggeeds-----ereedeEPETE---DSQESDA------PDSHSDLESD---GDSEQEEivhe 398  Tasmanian devil
XP_014345247 340 eageEDKSeEEESGNEAeegvser-----gneegsEEEAEVDTEEEESEG------EDSHSDLESE---IGSEEDEhane 405  coelacanth
XP_030841150 332 dqgeSDSEeKEEEgeeev------------qeddeEEEEDDESEEGEEEE------EDNASDLDSE---TDEDDDEddrt 390  purple sea urchin
Q54K79       478 tk-------------------------klktnKKSKEEVNETIPFTFDTPKSIEELDEWLLNRTSEEKETILTRIGVCNH 532  Dictyostelium ...
XP_006627260 407 ktdkeeaf------------pvvqktlteeerIAQQEAAKAELPYTFAAPESYSDLLSLIQGHSPEKQCIIVGRIQKCNH 474  spotted gar
XP_003965217 413 akets------------------akplsqeeiKAQQEAAKSELPYTFAAPESFSELKDLLCNHTPDNQRLILARTLKCNH 474  torafugu
XP_004074632 409 degkp------------------kktlskeemKAHQQAAKAELPYTFAAPESYEDLKDLLCGHTPENQRLIVARTQKCNH 470  Japanese medaka
XP_005812725 407 eeasssr---------------qqqtlsreelKAQQEAAKAELPYTFTAPESYEDLKDLLHGHTPDNQRLIMARTQKCNH 471  southern platy...
XP_003455004 411 spkpk-------------------ktlskeevKAQQEAAKAELPYTFAAPESYNDLKDMLRGHTSDNQRLIVARTQKSNH 471  Nile tilapia
XP_003461905 387 apgg----------------------gpkgdtGKACKASSSELPYTFEVPESREELKSLLSGRSAEEQLLVVERIQKCNH 444  domestic guine...
XP_003773477 399 nknkkpvq-------------apekntndakqKAVFEAARSELPYTFTAPDSYEELKSLLSGKSAEQQLVVIERIQKCNH 465  Tasmanian devil
XP_014345247 406 ktekkk-----------------skglceegkKAVIEAAADEIPFTFAAPGSYDDLKSLLTGHSAENQCTIIQRIQKCNH 468  coelacanth
XP_030841150 391 vkeiksslkkgnkqsvtkkvsiqepvekkkkiEEMMRLAKEELPYTFKAPTCLEELEGVLTGHSPSNQLTIIERMIKCHH 470  purple sea urchin
Q54K79       533 VSIKPQNKDKMKDY----LPILYQRFINIAKPIKEDdqdessnpidWIELDVLSKYIFEISQDVPIVSGITSKDLINSCY 608  Dictyostelium ...
XP_006627260 475 PSLASGNKFKLQKL----FGFLLEYVGELATR--TPa--------dLLTVNKLVPQLYGLCQMFPEAACTSMQSILCDSA 540  spotted gar
XP_003965217 475 PSLAVGNKLKLQKL----FGFLLEYVGDLASR--TPp--------eLTTVDKLIPELYNLCQMYPEAACKAMQSILGDAA 540  torafugu
XP_004074632 471 PSLAVGNKLKLQKL----FGFLLEYIGELALR--TSp--------eLTAVDKLLPELYALCQMFPEAAAAAVQLVLADAA 536  Japanese medaka
XP_005812725 472 PSLAAGNKPKLQKL----VGFLMEYMGELATR--SPp--------eLCTIDKLIPELYALCQMFPEAAGKSMQSILGDAA 537  southern platy...
XP_003455004 472 PSLAVGNKLKLQKL----FGFLLEYIGELASR--SPp--------eLSTIDKLIPEVYALCQMFPDAACKAMQSILGDAA 537  Nile tilapia
XP_003461905 445 PSLAVGNKAKLEKL----FGFLLEYVGDLATSDPPD----------LNVIDKLVVPLYHLCQMFPQSASSSVKFVLRDAM 510  domestic guine...
XP_003773477 466 PSLAVGNKAKLEKL----FGFLLEYIGDLATK--TPp--------dLKTVDKLIVQLYNLCQMFPEFASSSVKFVLRDVV 531  Tasmanian devil
XP_014345247 469 PSLAVGNKAKLEKL----FGFLLEYVGELATK--QPp--------eMRIIDKMVPHLYSLCQMFPETAAKCVQTVLRDSA 534  coelacanth
XP_030841150 471 PSLSDGNKAKLETLttciYQLMGKYVKEGKDL--QP-----------QFINGLTKHLYDLTQTCALASGNSLMGIICEKY 537  purple sea urchin
Q54K79       609 KRICKKLEIQsK---LNYWPNQQELLVIKLIGNVFPTSDFQH-PVVTPTIEALNFFLSHCPIRNANDIISSLFTMNLLFF 684  Dictyostelium ...
XP_006627260 541 HDMEEa----iElkgRSPFPGLDMLIYLKIASLLFPASDFRH-PVVTPAMVYISQSLTKCPVTTLEDVTTGLVLCSLTIE 615  spotted gar
XP_003965217 541 HSMEEv----lEvkgRAAFPSLDMLIYLKVTALLFPTSDFRH-PVTTPALLYISQALTRCPVRSLQDVTSGLVLCCLAVE 615  torafugu
XP_004074632 537 HSMEEq----iEvrgHAPFPTLDSLIYLKLTALLFPTSDFRH-PVTTPALLYISLALTKCPVRSLQDATAGLLLCCLAVE 611  Japanese medaka
XP_005812725 538 HSMEEa----vEvkgHAAFPTLDMLVYLKVTALLFPTSDFRH-PVTTPALLFISQTLTKCPVRSLQDLTSGLVLCCLAVE 612  southern platy...
XP_003455004 538 HSMEEt----lEvkgHAAFPTLDMLIYLKVTALLFPTSDFRH-PVTTPALLFISQALTKCPVRSLQDLTSGLVLCSLAVE 612  Nile tilapia
XP_003461905 511 HDMEEMIETK-G---RATFPGLDVLIYLKIAGLLFPTSDFWH-PVVTPALLCMSQILTKCPVLSLQDVVKGLFVCCLFLD 585  domestic guine...
XP_003773477 532 HEMEEm----iEikgRASFPGLDVLIYLKITGILFPTSDFWH-PVVTPALVCMSQILTKCPVTSLQDVVKGLFVCCLFLE 606  Tasmanian devil
XP_014345247 535 HEMEEl----lEvkgRVAFPGLEMLIYLKIIAALFPTSDF-RhPVATPALIYMSQLLTKCPVTSLQDVATGLFVCCLFLQ 609  coelacanth
XP_030841150 538 ESFNKe----tEdrgRSTFPSLDVLLYFKLVSALFPTSDFRH-SVVTPTMLFMGAILSQCQVRSCQDVTFGLFICNLFLK 612  purple sea urchin
Q54K79       685 YLSPSKRYSPEISSLLISLLSTFINhnpptiqttttTTtkpknskNSKTTTATTTTTPSNInsqwasistniliptillp 764  Dictyostelium ...
XP_006627260 616 YVSLSQRFVPELINFLLGILHLAVPdktsl-gyavvPPfkakgksSDLLVVKNEK-VAEVWki----------------- 676  spotted gar
XP_003965217 616 YVSFSKRFLPELINFLLGILHLAVRdkttl-gyslvPPfratgklTDLLVLSDWE-SCKTWsk----------------- 676  torafugu
XP_004074632 612 YVSFSKRFLPELINFLTGSLHLAVRdktsl-gytvvPPfrpagkcSDLLVLSDPE-SCRSWrk----------------- 672  Japanese medaka
XP_005812725 613 YVSFSKRFLPELINFLSGTLHLVVQdkast-gcmvvPPfrlsgkySDLLVLSNSE-SCSSWsk----------------- 673  southern platy...
XP_003455004 613 YVSFSKRFLPELINFLVGTLHLAVQdkasl-gyivvPPfrasgkySDLLVLSSSE-SCRTWsk----------------- 673  Nile tilapia
XP_003461905 586 FVSLSRRLIPELMNFLLGVLYIAAPnkqgy-gstvvHPfrargknSELLLVSDREDTATWQrg----------------- 647  domestic guine...
XP_003773477 607 YVSLSQRFVPELINFLAGVLHIATPnkdtq-gytlvHPfkplgrnSELLLVSSKD-DMDTWpk----------------- 667  Tasmanian devil
XP_014345247 610 YVSLSQRFVPELINFLLGILHLAVPnkgtp-eyilvPPfksvgktSELLVVKDKT-VMESWkk----------------- 670  coelacanth
XP_030841150 613 NVSLSKRLVPEVMNFLQGILYMASDheskt-aglvvAPfkqsgrfSKLLRHEGTS-EAQ--------------------- 669  purple sea urchin
Q54K79       765 lnylklsnqinvikkiepTQLEFSNLSK------SNLEINDELRINILNYLIS--FLEKYIRFYSESQfneSLPSLFTNI 836  Dictyostelium ...
XP_006627260 677 ----------------kqQPLSAVQGLKfkd-sleI---D-HFKFSSLATCLD--LVKRCTSLYKSLP---SFSKVFQPI 730  spotted gar
XP_003965217 677 ----------------ksLPLSATQSLDlkt-dleR---D-HHRLTCLSICLD--LVKRCSLLYRDLP---SFTVILQPI 730  torafugu
XP_004074632 673 ----------------kpLPLSATRCLElks-dldR---D-HHRLTCLSVCLD--LVKRCCLLYNDLP---SFSHVFQPV 726  Japanese medaka
XP_005812725 674 ----------------knLPLSATQQLElen-dlnK---D-HYRLNCLSTCLD--LVKRCCLLYKDLT---SFTHIFQPI 727  southern platy...
XP_003455004 674 ----------------ksLPLSATQQLDlkn-dpdR---D-NHRLTCLSTCLD--LVKRCCLLYKDLP---SFTHIFQPI 727  Nile tilapia
XP_003461905 648 -----------------sLSLRWASGRSv-----PTTAEANHIRLSCLAVALA--LLRHCVTMYSALP---SFHTVVRPL 700  domestic guine...
XP_003773477 668 ----------------rgLPLSRVNTLKess-eteT---N-HVRLSCVSVCLN--LIKRCLTMYSTLP---SFPEIMKPI 721  Tasmanian devil
XP_014345247 671 ----------------qhLPLSALQVLEgkd-elqL---N-HFRLSCIATCLD--LVKKCITLYGQLT---AFQEIIQPI 724  coelacanth
XP_030841150 670 --------------------LRPVKILDlvtdleDL---D-QAEFSTWALGLTchLLHQFSTLYVDLP---SYSEIFSPI 722  purple sea urchin
Q54K79       837 LNLLNK--LDTNTMNLKLIEKINSLKQLIDSINKEIINkrkPLILLTSKPQTLRQFNPRFNQVFSFFNK-----DPDAER 909  Dictyostelium ...
XP_006627260 731 GTLLMKh-LPVENYPSHLRALHQDILEAIN-STPTSHV---PLVLEKKKPVPLKLYTPKIVEVLDYGKKrg--cTK--QE 801  spotted gar
XP_003965217 731 KTLLSKh-LTAQTIPAALQELHKVILETID-SAPVAHP---RLVFEKKKPIPLKLLTPKIVEVLDYGKKrg--cTR--EE 801  torafugu
XP_004074632 727 GSLLSKh-LSIQTLPEALQELHREIMDAIS-SAPTTHR---HLVFNKKKPIPLKLLTPKIVEVLDYGKKrg--cTR--EE 797  Japanese medaka
XP_005812725 728 RTLLSKh-LCSQMLPSPLQELHSEILDAIS-SASVTHT---RLVFEKKKPIPLKLFTPKIVEVLDYGKKrg--sTR--EE 798  southern platy...
XP_003455004 728 RTLLSKh-LSTQTLPEPLQELSSEIVEAIS-STPVTHS---PLVFDKRKPIPLKLLTPKIVEVLDYGKKrg--sTR--EE 798  Nile tilapia
XP_003461905 701 RALLAEh-QAERSHPPELQELSQNILSDLE-SQKQLYR---PLICEKSKPVPLKLFTPRLVKVLEFGRKq---gGSSKEE 772  domestic guine...
XP_003773477 722 RVLLTKh-VPECGYPRELQELCQSILQEME-NQDKNYQ---PLVCEKSKPVPLKLFTPKVVKVLEFGRKqg--sSK--EE 792  Tasmanian devil
XP_014345247 725 RILLTKq-PFTEEYPPEIQVLHEEVLREIE-NKPKQYS---PLVFERKKPVPLKLYTPKIVEILDFGKNkg--gSR--QE 795  coelacanth
XP_030841150 723 YILLQDkeLLLNKYHHDVQSLGDEVLSHIEGSRQRTRR---VLEVEKKKPAPLKMFEPKIEENYDPTRKyrssgNK--EH 797  purple sea urchin
Q54K79       910 NHTAKMKALIKKETKGALREIVKDNQFIQAEKFKKATEERKENEKKRKQIMSELQSEQQE 969  Dictyostelium discoideum AX4
XP_006627260 802 RERERLKHKYKKEFKGALREIRKDTRFLAREKLSEVMARDSERKRKVKELFGSLATQEGE 861  spotted gar
XP_003965217 802 KEKERLKHKYKKEFKGALRELRKDSRFLAREKLNEVVQRDTERKKKVKELFGSLASQEGE 861  torafugu
XP_004074632 798 REKERLKHKYKKEFKGALREIRKDSRFLAREKLNEVMNRDAERKRKVKELFGSLATQEGE 857  Japanese medaka
XP_005812725 799 REKERLKHKYKKEFKGALREIRKDSRFLAREKLNEVMNRDAERKRKVKELLGSLATQEGE 858  southern platyfish
XP_003455004 799 REKERLKHKYKREFKGALREIRKDSRFLAREKLNEVMNRDAERKRKVKELMGSLATQEGE 858  Nile tilapia
XP_003461905 773 QERKRLIHKHKREFKGAVREIRRDNQFLARMQLSETMERDAERKQKVKQLFHSLATQEGE 832  domestic guinea pig
XP_003773477 793 QERKRLIHKHKREFKGAVREIRKDNQFLARMQLTEIMERDSERKRKVKQLFGSLATQEGE 852  Tasmanian devil
XP_014345247 796 REQKRLIHKHKREFKGAVREIRKDSQFLARQQLSETLERDAERKRKVKELFGSLATQEGE 855  coelacanth
XP_030841150 798 DEQQRLKHRHRREMKGAVREIRKDTQFIARQKLKEQKERDDERKEKVMRLHQMLATQEGD 857  purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap