Conserved Protein Domain Family
Ctr

?
pfam04145: Ctr 
Ctr copper transporter family
The redox active metal copper is an essential cofactor in critical biological processes such as respiration, iron transport, oxidative stress protection, hormone production, and pigmentation. A widely conserved family of high-affinity copper transport proteins (Ctr proteins) mediates copper uptake at the plasma membrane. A series of clustered methionine residues in the hydrophilic extracellular domain, and an MXXXM motif in the second transmembrane domain, are important for copper uptake. These methionine probably coordinate copper during the process of metal transport.
Statistics
?
PSSM-Id: 398012
Aligned: 423 rows
Threshold Bit Score: 34.975
Threshold Setting Gi: 402468190
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006676355        290 MYFHFGYSDYILFDSWVPRSTFSYALGCLFCFLLAIGYEFLLvvgsGLDTAWKMVEssrHsndvglgDTLELPMSGSDHS 369 Batracho...
EGD75061             76 MYFMLGHKTTILFKDWETKTMGQYVGSCVGVLILAIIYEWGKilraDLDMWISRRIapkPccmslinSSTHQPNSHHSPP 155 Salpingo...
EFX67187             23 MYFYADYKAVVLFQGWDIQTVGAMVGSCIGIFLMGILYEGLKyfreYL-------------------------SSKHYTS 77  common w...
3_pfamImport          1 MYFNFNLPVTVLFYEWEIKDSGALIGSCVGVAGIGILYELLKymrqQW-------------------------AKKMYAN 55 
XP_002076591         23 MVFHAGHCERILWRGWVASTVTEFVLSALAIFLVSFLYEALKflrqQL-------------------------ARREARR 77  Drosophi...
EDV91404             17 MVFHGGHCERILWRGWVASTVVEFTFSAIAFFVLAFIYELLKflrnYL-------------------------LQREARK 71  Drosophi...
XP_002054541         26 MVFHGGHCERILWRGWVAATVTEFAFSCIAFFVLSFLYELLKflreHL-------------------------IRREARR 80  Drosophi...
WGS:AAPU:GI24869-PA  24 MVFHGGHCERILWRSWVAYTVTEFAFSCIAFFAMSFLYELLKflrvQL-------------------------VRREARK 78  Drosophi...
7_pfamImport          1 MTFTNKLPFFLLLKSIEITTYMDLTIACFTLFLVGFIYESLKtvrlRIATMTSCPVsccGcqeqrdvSAKSDVNGLVALT 80 
XP_002122602         21 MTFTNQLPFFLLLKSIEIRNNMELAIAGFIMFLLGVFYEFLKhyrlCLASMTTCPVsccScneqhsdIKESKSNESIVRT 100 vase tun...
XP_006676355        370 FGLYRSPMENPNISVlsddtpllrprsritgkrrtslnisthpklqpnhesqnlplcpttdltdqidmgpdgeeesvfdh 449 Batracho...
EGD75061            156 AA------------------------------------------------------------------------------ 157 Salpingo...
EFX67187             78 VTYNNVKTPG---------------------------------------------------------------------- 87  common w...
3_pfamImport         56 KVRSFVPST----------------------------------------------------------------------- 64 
XP_002076591         78 ESEQLAAEQRRKNE------------------------------------------------------------------ 91  Drosophi...
EDV91404             72 VAEQTAAEIRRKR------------------------------------------------------------------- 84  Drosophi...
XP_002054541         81 EAELAAELRQKNS------------------------------------------------------------------- 93  Drosophi...
WGS:AAPU:GI24869-PA  79 EAEQLAEEQRRKA------------------------------------------------------------------- 91  Drosophi...
7_pfamImport         81 KLITKQPQQNGNGMNgndgsggkd-------------------------------------------------------- 104
XP_002122602        101 KLVVKQPIRNGLPKIddsrm------------------------------------------------------------ 120 vase tun...
XP_006676355        450 smsessshihqrvishgntsqaaglsdflqhhsgDIshhsnqhTPTQYLSRLYTKKWTHLQMR---------IGRALIRL 520 Batracho...
EGD75061            158 ------------------------------------------------------PDCVPWHYQ---------LLRTVCHI 174 Salpingo...
EFX67187             88 ----------------------------------------------EAGSETSSQVNRTPMSFktsvtsashYIQTALHL 121 common w...
3_pfamImport         65 ----------------------------------------------SDCCQEDDDLECYTISYkspkfwlfhVVQTILHM 98 
XP_002076591         92 -----------------------------------A-------PAAGGCCSETPLAEPREQTYwqrllasshIVQSLLNL 129 Drosophi...
EDV91404             85 -----------------------------------E-------INDCAGCSETPLAEIREETYwqrifnsahIIQSLLYL 122 Drosophi...
XP_002054541         94 -----------------------------------V-------NDCGGGCSETPLAEIREKTYwqrilntphIIQSLLNL 131 Drosophi...
WGS:AAPU:GI24869-PA  92 -------------------------------------------LGDCNGCSETQLAEIKDKTYwqrifnmphIIQTLLTF 128 Drosophi...
7_pfamImport        105 -------------------------grdgrngfhDTev----rISNDKQTGPRSKQKSAVAIH---------LIEVLVHG 146
XP_002122602        121 ------------------------------dtevRIk------KEKQREDSSPIPHGTLVTIH---------LIETLVHG 155 vase tun...
XP_006676355        521 VTITLAYICMLLVMSFNVGLFLSVVVGLAVGKFMW 555 Batrachochytrium dendrobatidis JAM81
EGD75061            175 VHFTLAYFLMLIAMTYSVGLFVSMVLGSGVGYFLF 209 Salpingoeca rosetta
EFX67187            122 LQMIISYLLMLIVMTYNVWLFMAVVLGCTVGYFFF 156 common water flea
3_pfamImport         99 VQVAIAYFLMLIVMAYNVWLAISVVAGAGVGYFIT 133
XP_002076591        130 LQIVISYLLMLIFMTFNYWLCLAVILGLGLGYFFF 164 Drosophila simulans
EDV91404            123 VQVIISYLLMLVFMNFNYWLCLAVVLGLAAGYFFF 157 Drosophila grimshawi
XP_002054541        132 VQIIISYLLMLVFMNFNYWLCLSVVLGLGVGYFFF 166 Drosophila virilis
WGS:AAPU:GI24869-PA 129 IQLIISYLLMLVFMNFNYWLCLSVILGLSFGYFFF 163 Drosophila mojavensis
7_pfamImport        147 AQLFVSYIIMLAVMTYNVCIVASVICGCMTGYLVC 181
XP_002122602        156 VQLLVSYVIMLSVMTYNVSIVICILAGCMVGYFTS 190 vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap