Conserved Protein Domain Family
SCAMP

?
pfam04144: SCAMP 
SCAMP family
In vertebrates, secretory carrier membrane proteins (SCAMPs) 1-3 constitute a family of putative membrane-trafficking proteins composed of cytoplasmic N-terminal sequences with NPF repeats, four central transmembrane regions (TMRs), and a cytoplasmic tail. SCAMPs probably function in endocytosis by recruiting EH-domain proteins to the N-terminal NPF repeats but may have additional functions mediated by their other sequences.
Statistics
?
PSSM-Id: 398011
Aligned: 123 rows
Threshold Bit Score: 76.808
Threshold Setting Gi: 121887126
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KJE95585     119 KPNFPF--FYPIVYISIAHDMPEQtMRNQIRLALTLWFFMMAAFIWGF-LSVMIPFFDGDAlnksagwdndtaAF-FLAL 194 Capsaspora owcz...
XP_002970903  93 EKNWPP--FFPIIRHDIRRDIPLH-LQRLQYMAFASWLGFVLCLAWNF-IAVSGAWAHKAVsss------ygvQIwFLAI 162 Selaginella moe...
XP_002963054 114 EKNWPR--FFPILHHDIAADIPAY-LQRMQYFAYGSWLGILLCLTWNF-ISVTGAWIQKTVsas------ygvQIwFLAI 183 Selaginella moe...
XP_015695822  93 vKNWPP--FFPIIHHDITNEIPIH-AQKLQYMAFASWLGLVVCLSWNV-LAVLIESIHTEd-----------iVLfLLAI 157 malo sina
XP_002862723  93 DKNWPS--FFPIIHH---NEIPLH-AQKLQYLAFASWLGLVFCLIFNV-IAVIVCWIEGGg-----------vKIfFLAT 154 Arabidopsis lyr...
XP_009385714  93 EKNWPP--FFPIIHHDIAKEIPVH-AQRLQYLAFASWLGILLCLSWNV-IAVIVCWIKGGg-----------vKIfFLAI 157 wild Malaysian ...
EFN58222     102 TKNWPK--FCPVLHHDIAGEIPAQ-SQVPVRRAYWAYLGLILCLFWNF-MGVSALLITDGGe----------iAAwLWGA 167 Chlorella varia...
XP_003064282 154 QKNWPFk-RYAIAFHDIELEIPEE-CQRAVHHAHYAFWGLVFCLTYNFlFAASAAFFGLGDf-----------AAwIMAI 220 Micromonas pusi...
XP_002502709 140 PKNWPIpgYWVIWHHDIDGDIRNDqVAAAVKMSYYSFLLLTLSLVYNFlFCATAAMFTGMEsg---------fSAwLMAL 210 Micromonas commoda
XP_006647732 110 DKNWPP--FFPIIHHDIANEIPAN-AQKLQYLAFASWLGIVLCLFWNF-IAVIVCWIRGGd-----------sKLfFLAT 174 malo sina
KJE95585     195 IWMLAGVPLSFYFwFFRLYTLHRDlgadktpgVSYfFWFFHGLVNFLWCCIYAIGPPq-----IPGMAGFVVAVNIFnas 269 Capsaspora owcz...
XP_002970903 163 IYMLAGIPGSYGLwYRPLYKAMRSds-----gLRFgWFFLCYLVHICFCIVASIGPPiv--fkGKSLAGILPALQVF--- 232 Selaginella moe...
XP_002963054 184 IYILAGFPGSYFLwYRPLYRAMRSes-----aLKFgWFFIAYLFHILFCIFCAVAPPiv--fkGRSLTGILPAIQIF--- 253 Selaginella moe...
XP_015695822 158 IYAISGCPLSYILwYRPLYCAMRTds-----mVTFgQFFVFYSMHVGFCVIAAVAPPii--fkGNTLTGILVAMEVL--- 227 malo sina
XP_002862723 155 IYASLGCPVSYVLwYKPLYLAMRTds-----aLKFgWFFFFYLIHIGFCIFAAIAPPii--fhGQSLTGVLAAIDVI--- 224 Arabidopsis lyr...
XP_009385714 158 IYALLGCPLSYVLwYRPLYRAMRTds-----aLKFgWFFLFYLIHVGFCILAAIAPPiv--fhGKSLTGILAAIDTF--- 227 wild Malaysian ...
EFN58222     168 IWMVGGVPGAYILwYSRLYNASIKds-----aFGYaIFFAGFFANLAFSVWSAVGPPfl---gEKSHTGYISAINRI--- 236 Chlorella varia...
XP_003064282 221 LYLITGVPGAYFFwYARLYNATKNds-----aLGYaWFFIVFLVHIAFCLFAFIAPPdafgtaKYSLAGVMSTAEME--- 292 Micromonas pusi...
XP_002502709 211 VYMLTGVPGAFYLwYKRLYSAAKNds-----aMNYlWFFVVYLAHIAFCMYAFIAPTsafstpTYSLAGIMSTAAAM--- 282 Micromonas commoda
XP_006647732 175 IYGMLGTPLSYLMwYRPLYRAMRTds-----aFSFgWFFLCYMLHIAFCVFAAIAPPvi--frGKSLTGILAAIDTF--- 244 malo sina
KJE95585     270 eDSNKLYATFIVISGVIWTVCAGFSLLFLLWI 301 Capsaspora owczarzaki ATCC 30864
XP_002970903 233 -SNTVGVGILYLVGFALFCLETLLCIWVLQQV 263 Selaginella moellendorffii
XP_002963054 254 -SDSVIIGIFYLVGFGLFVLESLLSLWVLREV 284 Selaginella moellendorffii
XP_015695822 228 -TGNMFTGVLYLIGFAFFTLESIISIWVLEKV 258 malo sina
XP_002862723 225 -SASLLAGIFYFVGFGLFCMELLLSLWVLQKT 255 Arabidopsis lyrata subsp. lyrata
XP_009385714 228 -SDHALVGIFYLVGFGLFCLETLISLWVLQRV 258 wild Malaysian banana
EFN58222     237 -GDNTGVGVMYFIGAGLWTLESLWSLWVYKLV 267 Chlorella variabilis
XP_003064282 293 -KENSSIGGVYAFGAALWFLELLWSVWVIRGV 323 Micromonas pusilla CCMP1545
XP_002502709 283 -EKNKGTGGVYAFGVCLFGVTLIVSVNAVRMV 313 Micromonas commoda
XP_006647732 245 -SDHAIVGIFYFVGFALFCLETLVSIWVLQKV 275 malo sina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap