Conserved Protein Domain Family
GtrA

?
pfam04138: GtrA 
GtrA-like protein
Members of this family are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. The GtrA family are a subset of this family. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved is in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyzes the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b). This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose.
Statistics
?
PSSM-Id: 398007
Aligned: 116 rows
Threshold Bit Score: 46.0102
Threshold Setting Gi: 81539724
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q976M4          7 KYAIVGGLGTIVNEGILLSTK--PFIPIAISLALAIEISILFNFILNDIWTFKDSRKGKI--ITRLWKFHVSSLVGGIVQ 82  Sulfurisphaera...
WP_011971446   10 NYLIFGVLTTAVNLVIYTILIr-FGLHYLISTTIAFILAVSVAFYTNRKWVFDSDVKEQKglMKEMSTFFVVRIGTYFFD 88  Alkaliphilus m...
Q04GQ6         17 nYIIFGVSAFFISFLVFALLEqlTPMDWATANIVAWIAATIFSYYTNRSYVFNSHHEKFLseAIEMARFFVGRGFTLIAE 96  Oenococcus oen...
Q03WD5         16 LYIVFGGLTMLVNIIAFWLAFqaWHMNSSVSYLFAWFWSIFFAYLTNRTWVFHSTAHDLKtvINEIFQFLVARIATAVIG 95  Leuconostoc me...
Q1WSQ1         14 AYLFFGGLTTLINFVVFFIFDsgLHWNYQVANFIAWFLSVLFAFFTNKVWVFGSKYTTVKafFIEMWSFFFYRILSYFID 93  Lactobacillus ...
P39602          1 MYIIMGVFTTIVNIASFYILVeiMNVDYKAATVAAWILSVLFAYITNKLYVFQQKTHDLQslLKELTAFFSVRVLSLGID 80  Bacillus subti...
jgi:Cphy_1342  44 TYAIAGVLTTLVNLITFDLIAnkMHVNDLVANIIAWIFAVSFAYVVNNFWVFHSGVGKEYkeVEKILKFFGARLVTLGIE 123 Lachnoclostrid...
Q8DT47         20 KYIFFGILTTFVYFLTRTPLFf-ITKEATLSAVIANVTSITFAFFTNDYFVFNQKRQGW---LKRFIQFFIARLSTLALD 95  Streptococcus ...
Q8E086         18 lYLLFGLLTSLLYLVIRQGIFn-FSQDAPFSAIVANIIAILFAFFTNDRFVFKQTKIEQ---LQRLQTFVIARLGTLGLD 93  Streptococcus ...
Q04D83         13 lYLIFGILTTVVYFIARFLTLn-LSKNALLAVAVAQILAILFAFITNKIWVFKKAEKAPL--LIQFLKFVAARLFVFLLD 89  Oenococcus oen...
Q976M4         83 YVIvisLVVLFiHFgNLtqllfllff-------------------sslhlsslyLAIInflGIVAGF-G---VRFILSIR 139 Sulfurisphaera...
WP_011971446   89 LFG---LILLI-QLaDM-------------------------------------DELI---SKLIVNgGvivLNYALSKW 124 Alkaliphilus m...
Q04GQ6         97 QLI---LWIGI-QLlGMys---------------------------------ltVKLI---AQIVVI-T---LNYLISKF 132 Oenococcus oen...
Q03WD5         96 FVI---FYFGV-NLlKQda---------------------------------qiWNII---QNIFVI-I---SNFALSKL 131 Leuconostoc me...
Q1WSQ1         94 AGI---MFVGI-SLlHAns---------------------------------slTKLI---DQVVIV-V---LNYFFSKF 129 Lactobacillus ...
P39602         81 LGM---MIILV-GQfNTne---------------------------------tlAKIL---DNAVIV-V---VNYVASKW 116 Bacillus subti...
jgi:Cphy_1342 124 EAG---ILCFV-TWlHF-------------------------------------NNMVvklGLAVIViI---VNYIFSKL 159 Lachnoclostrid...
Q8DT47         96 LLL---AFLLV-DKfPGiigrfvrn---------------------nhdminfiETII---SQFLIM-A---TNYIISKF 143 Streptococcus ...
Q8E086         94 LIL---AVIFV-DQfPSiigqfvqh---------------------nlnkintiESLV---SQILII-L---LNYILSKF 141 Streptococcus ...
Q04D83         90 FFI---TWLCI-EKyGRffinffalnhlnyqsgittfpiisgfigsptlantfiWSMF---VQIAAI-I---LNYVFSKL 158 Oenococcus oen...
Q976M4        140 YVW 142 Sulfurisphaera tokodaii
WP_011971446  125 VVF 127 Alkaliphilus metalliredigens
Q04GQ6        133 IVF 135 Oenococcus oeni PSU-1
Q03WD5        132 VIF 134 Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Q1WSQ1        130 FIF 132 Lactobacillus salivarius UCC118
P39602        117 LVF 119 Bacillus subtilis subsp. subtilis str. 168
jgi:Cphy_1342 160 YIF 162 Lachnoclostridium phytofermentans ISDg
Q8DT47        144 FIF 146 Streptococcus mutans
Q8E086        142 VIF 144 Streptococcus agalactiae serogroup V
Q04D83        159 FIF 161 Oenococcus oeni PSU-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap